SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g02300

Feature Type:gene_model
Chromosome:Gm06
Start:1527105
stop:1528358
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g02300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G76100AT Annotation by Michelle Graham. TAIR10: plastocyanin 1 | chr1:28554217-28554732 REVERSE LENGTH=171 SoyBaseE_val: 7.00E-74ISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF00127PFAM Copper binding proteins, plastocyanin/azurin family JGI ISS
UniRef100_B9R8G0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plastocyanin A, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9R8G0_RICCO SoyBaseE_val: 3.00E-88ISS
UniRef100_C6SVR0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVR0_SOYBN SoyBaseE_val: 4.00E-114ISS

Expression Patterns of Glyma06g02300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g02300
ParalogEvidenceComments
Glyma04g02240 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g02300 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g020400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g02300
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g02300
>Glyma06g02300.1   sequence type=CDS   gene model=Glyma06g02300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACCGTCACTTCTGCAGCAGTTTCTATTCCCTCATTCACTGGCCTCAAGGCAAGCGCAGGCAAAGTGAGTGCCGCCGCAGTTAAAGTCTCAGCTCCCCAAGCCACAAGGTTCTGCGGCATCAAGGCTTCCCTCAAAGACGTTGGAGTCGCTGTTGTGGCCACTGCTGCGAGCGCAGTTCTAGCTAGCAACGCCATGGCCATTGAAGTGTTACTGGGCACTGATGACGGGTCTCTGGTTTTCTCTCCCAACTCTTTCTCCGTGGCCCCTGGGGAAAAGATCGTGTTCAAGAACAACGCAGGTTTCCCCCACAACGTTGTGTTCGACGAGGACGAGATTCCTAGCGGCGTGGATGCAGGGAAAATCTCCATGAGCGAAGAAGACCTTCTCAATGCGGCTGGTGAGACTTACAGCGTTACTTTGGATGCCAAGGGAACCTACAGTTTCTACTGTTCGCCTCACCAAGGAGCTGGTATGGTGGGAAAAGTCACCGTTAATTAA
Predicted protein sequences of Glyma06g02300
>Glyma06g02300.1   sequence type=predicted peptide   gene model=Glyma06g02300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATVTSAAVSIPSFTGLKASAGKVSAAAVKVSAPQATRFCGIKASLKDVGVAVVATAASAVLASNAMAIEVLLGTDDGSLVFSPNSFSVAPGEKIVFKNNAGFPHNVVFDEDEIPSGVDAGKISMSEEDLLNAAGETYSVTLDAKGTYSFYCSPHQGAGMVGKVTVN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo