Report for Sequence Feature Glyma06g02220
Feature Type: gene_model
Chromosome: Gm06
Start: 1467395
stop: 1470348
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g02220
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G20460 AT
Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G76185.1); Has 37 Blast hits to 37 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 37; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:7091505-7092993 FORWARD LENGTH=106
SoyBase E_val: 2.00E-50 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1JSX6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSX6_SOYBN
SoyBase E_val: 2.00E-67 ISS
UniRef100_Q9LMV5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: F5M15.20 n=1 Tax=Arabidopsis thaliana RepID=Q9LMV5_ARATH
SoyBase E_val: 2.00E-06 ISS
Expression Patterns of Glyma06g02220
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g02220
Paralog Evidence Comments
Glyma04g02120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g02220 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g019600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g02220
Coding sequences of Glyma06g02220
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g02220.2 sequence type=CDS gene model=Glyma06g02220 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATAACACGATCGAATCTGGTTGAACAGCTGCGAGAGTATCAGATTCGATCCAAGCATGATTGGGCCTCTGTCTCGTTCTTCTCCTCCACTTCTTCAAACATCACCACTTCCAGGGTGGATGTGGTGGTTTTTGTAATATGGGAACTTGTTATTTTAGCTTTCTTGGTCTTTTCCGTAGTCTCTTTGTACTTCAAGCACATCCGGCTTGCTTTTATTTTAGTCTGCATCACAATCCTATTGCTTTTATGCATGAAAATTACAAAGCAAGTAAGGCTTGCAAGGAAAAAGAGACGAAGGATGCTTCTTCCATTGTCAATGTAA
Predicted protein sequences of Glyma06g02220
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g02220.2 sequence type=predicted peptide gene model=Glyma06g02220 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MITRSNLVEQLREYQIRSKHDWASVSFFSSTSSNITTSRVDVVVFVIWELVILAFLVFSVVSLYFKHIRLAFILVCITILLLLCMKITKQVRLARKKRRRMLLPLSM*