SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g01780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g01780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g01780

Feature Type:gene_model
Chromosome:Gm06
Start:1126377
stop:1128934
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g01780
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G76405AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast envelope; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G20816.1); Has 52 Blast hits to 52 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink). | chr1:28661994-28663673 FORWARD LENGTH=167 SoyBaseE_val: 3.00E-75ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T5V0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5V0_SOYBN SoyBaseE_val: 2.00E-119ISS
UniRef100_Q9SM57UniRef Annotation by Michelle Graham. Most informative UniRef hit: Outer envelope pore protein 21, chloroplastic n=1 Tax=Pisum sativum RepID=OEP21_PEA SoyBaseE_val: 1.00E-100ISS

Expression Patterns of Glyma06g01780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g01780 not represented in the dataset
Glyma06g01780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g01780 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g015300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g01780
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g01780
>Glyma06g01780.1   sequence type=CDS   gene model=Glyma06g01780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGACCTCTCTGCGATACGGAGAAGATTCCAAAGCTTTACGAATCCATGCGAAGCAAAAACTCCGAATCGACTCCAACACCTACTTTCAGTTGCGCGGAGAGCTTGATACAAGACTTGGACAACCAAGTTCGTCCAGTGCCCTCATCAGACATTTCTATCCAAGTTTATCAGCAACCCTTGGCGTAGGAGTGCGTTATGATAAGCGTGACAAGTTGCGTTACACTGTGAGTGCAAAGAAAACATTTCCTGTCACTGTTGACGGCTTGCTCAATTTTAAAATCAAGGGTGGATGTGATGTTGACAAAGACTTTAAAGAGAGGAAGTCCAGAGGAGCCGCCGAGTTTTCATGGAACGTGTTCAATTTTCAGAAGGACCAAGATGTTAGACTTAGGATTGGCTACGAAGTATTTGATCAGGTTCCTTACCTGCAGATTAGGGAGAATAATTGGACAGTAAATGCAGATTACAAAGGTAGATGGAACGTGAGATATGACTTGTGA
Predicted protein sequences of Glyma06g01780
>Glyma06g01780.1   sequence type=predicted peptide   gene model=Glyma06g01780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METSLRYGEDSKALRIHAKQKLRIDSNTYFQLRGELDTRLGQPSSSSALIRHFYPSLSATLGVGVRYDKRDKLRYTVSAKKTFPVTVDGLLNFKIKGGCDVDKDFKERKSRGAAEFSWNVFNFQKDQDVRLRIGYEVFDQVPYLQIRENNWTVNADYKGRWNVRYDL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo