Glyma06g01650 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g01650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g01650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g01650

Feature Type:	gene_model
Chromosome:	Gm06
Start:	1054346
stop:	1055053
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g01650

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G76500	AT	Annotation by Michelle Graham. TAIR10: Predicted AT-hook DNA-binding family protein \| chr1:28705532-28706440 FORWARD LENGTH=302	SoyBase	E_val: 5.00E-69	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0009933	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem structural organization	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0010182	GO-bp	Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0019915	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid storage	SoyBase	N/A	ISS
GO:0050826	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to freezing	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
PF03479	PFAM	Domain of unknown function (DUF296)	JGI		ISS
UniRef100_Q9C9K7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT-hook motif nuclear localized protein 29 n=1 Tax=Arabidopsis thaliana RepID=Q9C9K7_ARATH	SoyBase	E_val: 2.00E-66	ISS
UniRef100_UPI0002339767	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339767 related cluster n=1 Tax=unknown RepID=UPI0002339767	SoyBase	E_val: 3.00E-166	ISS

Expression Patterns of Glyma06g01650

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g01650 not represented in the dataset	Glyma06g01650 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g01650 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g014100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g01650

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g01650

Limit To All Plant Sequences

>Glyma06g01650.2   sequence type=CDS   gene model=Glyma06g01650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACACCTGCAGCCCTACACCTCCAGCCCCAGTCCGACGACGACGACGGAGAAGGACCCTTCTCCACCCAGCGGCGCCCTCGCGGGCGGCCCATGGGCTCCAAGAACAAGCCCAAGCCACCCGTCATAGTCACGCGCGACAGCCCCAACGTCCTCCGCTCGCACGTTCTTGAGGTCTCCTCCGGCGCCGACGTGGTGGAGAGCCTCTCCAACTATGCGCGCCGCCGAGGGAGGGGAGTGTCCGTGCTCAGTGGCTCCGGCACGGTGGCCAACGTCGTGCTCCGTCAACCGGCCGGGAGCGTCCTCACGCTCCACGGCCGGTTTGAGATAGTTTCCATGACGGGGACGGTGCTCCCGCCTCCGGCGCCACCCGGTTCGGACGGGTTGTCGGTTTATCTGTCAGGGGCGCAGGGACAGGTGGTTGGGGGCGTGGTGGTGGCCCCTCTGGTGGCTTCGAGTCACGTGGTTTTGGTGGCTGCTTCCTTCGCTAACGCCATGTTCGAAAGGTTACCCTTGCCCTTGAATCAGCATGATGATGATGATCAAGTTCTGCAAGAGGCACCACGTGGCGTCATGGGAACTGAACAGGTGGCAGATGGAAGGAACTATCCCTTCTCCGCGTCGCTGCAGGGTGAAGTATTTGGATGGGGTGGAACTGGAACTACATCATCAACATCAACTGCACCACCCAAAACTCATCCTTTCTAG

Predicted protein sequences of Glyma06g01650

Limit To All Plant Sequences

>Glyma06g01650.2   sequence type=predicted peptide   gene model=Glyma06g01650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTPAALHLQPQSDDDDGEGPFSTQRRPRGRPMGSKNKPKPPVIVTRDSPNVLRSHVLEVSSGADVVESLSNYARRRGRGVSVLSGSGTVANVVLRQPAGSVLTLHGRFEIVSMTGTVLPPPAPPGSDGLSVYLSGAQGQVVGGVVVAPLVASSHVVLVAASFANAMFERLPLPLNQHDDDDQVLQEAPRGVMGTEQVADGRNYPFSASLQGEVFGWGGTGTTSSTSTAPPKTHPF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain