SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g01611

Feature Type:gene_model
Chromosome:Gm06
Start:1008171
stop:1009428
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g01611
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74950AT Annotation by Michelle Graham. TAIR10: TIFY domain/Divergent CCT motif family protein | chr1:28148919-28150258 REVERSE LENGTH=249 SoyBaseE_val: 5.00E-24ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF06200PFAM tify domain JGI ISS
PF09425PFAM Divergent CCT motif JGI ISS
UniRef100_G7IIQ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein TIFY 10B n=1 Tax=Medicago truncatula RepID=G7IIQ4_MEDTR SoyBaseE_val: 4.00E-37ISS
UniRef100_UPI0002339766UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339766 related cluster n=1 Tax=unknown RepID=UPI0002339766 SoyBaseE_val: 2.00E-110ISS

Expression Patterns of Glyma06g01611
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g01611 not represented in the dataset
Glyma06g01611 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g01611
ParalogEvidenceComments
Glyma04g01531 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g01611 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g013700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g01611
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g01611
>Glyma06g01611.1   sequence type=CDS   gene model=Glyma06g01611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTTGTTTCCCTCAATCAAGGCACCAACAACCATGCAGTCTGTTTATCCTCGCCACTTGGAAATTCCAACTCTTGTTAATCCAAGGTCTATGGAGAAGGAGCATAAAGCTGCTCAGTTGACCATCTTCTACAATGGGCAAGTTGTTGTGTTTGATGATTTTCCAGCTGATAAAGTGCAGGAGATGATGTCTTTGGCATTGGCCACCAAGGGAATATCCCAAAGCCAGAACTCCTCTGCATATGCTCACACTCATAACCAGCAAGGAAATAATCATCCTTCGACTATTCCTAATATCATCCCTCAAGCACCATCCACACCAATTGCTAATGACATGCCAATTGGTAGGAAAGCTTCCCTTCATCGGTTCCTTGAGAAGAGGAAAGATAGAATTGCTGCCAAAGCACCATATCAAACAAACAGACCTATCTCTGCTCCTAATAAGCCGGCTGAATCATTAGATGCTAAATCACACACCTGA
Predicted protein sequences of Glyma06g01611
>Glyma06g01611.1   sequence type=predicted peptide   gene model=Glyma06g01611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELFPSIKAPTTMQSVYPRHLEIPTLVNPRSMEKEHKAAQLTIFYNGQVVVFDDFPADKVQEMMSLALATKGISQSQNSSAYAHTHNQQGNNHPSTIPNIIPQAPSTPIANDMPIGRKASLHRFLEKRKDRIAAKAPYQTNRPISAPNKPAESLDAKSHT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo