|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G34110 | AT | Annotation by Michelle Graham. TAIR10: poly(A) binding protein 2 | chr4:16336732-16339892 FORWARD LENGTH=629 | SoyBase | E_val: 4.00E-23 | ISS |
| GO:0006413 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translational initiation | SoyBase | N/A | ISS |
| GO:0006486 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein glycosylation | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0003743 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR24011 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24011:SF69 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | ISS | |
| UniRef100_G7JK09 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Poly(A)-binding protein n=1 Tax=Medicago truncatula RepID=G7JK09_MEDTR | SoyBase | E_val: 6.00E-30 | ISS |
| UniRef100_I1JE12 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JE12_SOYBN | SoyBase | E_val: 1.00E-31 | ISS |
|
Glyma06g01445 not represented in the dataset |
Glyma06g01445 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g012300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g01445.1 sequence type=CDS gene model=Glyma06g01445 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACTCGGGTTCAAGTTCTGCCTCAGAATGCGATTCCCGACCCCAACGGTGGTGATGTTGCTGGAAATCAGTTCGTCATGACGTCGCTTTATGTCAGAGATCTCGACCCAAACGTCATGGACGCCCAGCTGTATGATTTGGTCAACCAATTGGGACAAGTCGTATCCGTTAGGGTTTGCAGGGACTTGACCAGTAGGAGATCGCTCGGTTATGATTATGTCAACTTTAGCAACCCGCAAGATGTTGCCGTCCTTCTCTCCTATTACATATTCACCCGGTTGTCTCGAAGAAATCTCGTCCATTTAATTTTTTTATTGTCAAATCAGACGAACGAGGTTGATTCTAATTTTTTTCGAAACTTACGTTGGGTGCGAAAAGAGTTTCACCTTCACACCTTAGTCTTCGTCATAATTATGTGA
>Glyma06g01445.1 sequence type=predicted peptide gene model=Glyma06g01445 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTRVQVLPQNAIPDPNGGDVAGNQFVMTSLYVRDLDPNVMDAQLYDLVNQLGQVVSVRVCRDLTSRRSLGYDYVNFSNPQDVAVLLSYYIFTRLSRRNLVHLIFLLSNQTNEVDSNFFRNLRWVRKEFHLHTLVFVIIM*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||