Report for Sequence Feature Glyma06g01400
Feature Type: gene_model
Chromosome: Gm06
Start: 870921
stop: 874585
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g01400
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G21600 AT
Annotation by Michelle Graham. TAIR10: endoplasmatic reticulum retrieval protein 1B | chr2:9243550-9244579 FORWARD LENGTH=195
SoyBase E_val: 2.00E-105 ISS
GO:0006890 GO-bp
Annotation by Michelle Graham. GO Biological Process: retrograde vesicle-mediated transport, Golgi to ER
SoyBase N/A ISS
GO:0006891 GO-bp
Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005783 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0005801 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cis-Golgi network
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG1688
KOG
Golgi proteins involved in ER retention (RER)
JGI ISS
PTHR10743 Panther
RER1 PROTEIN
JGI ISS
PF03248 PFAM
Rer1 family
JGI ISS
UniRef100_B7FGH1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Protein RER1B n=1 Tax=Medicago truncatula RepID=B7FGH1_MEDTR
SoyBase E_val: 3.00E-103 ISS
UniRef100_I1K766 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K766_SOYBN
SoyBase E_val: 6.00E-138 ISS
Expression Patterns of Glyma06g01400
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g01400
Paralog Evidence Comments
Glyma04g01360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g01400 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g011900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g01400
Coding sequences of Glyma06g01400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g01400.1 sequence type=CDS gene model=Glyma06g01400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGGAAGTGGCGGTGGCGGTGCTTCACCGTCTGCACCGGTGAAGCAGTATTTGCACGATTTCTCGAAGCTGTTTCAGTACTATCTGGATAAATCCACTCCACATTCCACGTACAGATGGATTGGGACTTTCGTGATAGCATCCATCTACGTTTTGCGCGTTGTTTATGTGCAGGGTTTTTACATTGTCTCTTATGGACTCGGAATCTACCTTCTGAATCTCTTGATTGGTTTTCTCTCCCCTTTGGTTGATCCTGAGCTCGATCCCTCCGACTCCCCTTTGCTTCCAACCAAAGGCTCCGATGAGTTCAAACCCTTCATTCGCCGCCTTCCGGAGTTCAAGTTCTGGTATTCTTTCACCAAGGCTCTCTGCATAGCGTTTGTGATGACCTTTTTTTCCCTGTTTGATGTTCCTGTCTTTTGGCCTATATTACTCTGTTACTGGTTTGTTCTCTTTGTCCTTACAATGAGGCGCCAAGTTGCTCACATGATCAAATACAAATATATCCCCTTCAACTTGGGGAAGCAGAAGTATAGCGGTAATAAATCTTCTGCAAGGAGCAGTAGCTCTCGTGCAGACTGA
Predicted protein sequences of Glyma06g01400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g01400.1 sequence type=predicted peptide gene model=Glyma06g01400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEGSGGGGASPSAPVKQYLHDFSKLFQYYLDKSTPHSTYRWIGTFVIASIYVLRVVYVQGFYIVSYGLGIYLLNLLIGFLSPLVDPELDPSDSPLLPTKGSDEFKPFIRRLPEFKFWYSFTKALCIAFVMTFFSLFDVPVFWPILLCYWFVLFVLTMRRQVAHMIKYKYIPFNLGKQKYSGNKSSARSSSSRAD*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
