Report for Sequence Feature Glyma06g01300
Feature Type: gene_model
Chromosome: Gm06
Start: 828908
stop: 830091
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g01300
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G34560 AT
Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G66440.1); Has 67 Blast hits to 66 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 67; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:16507923-16508588 FORWARD LENGTH=221
SoyBase E_val: 9.00E-19 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF05553 PFAM
Cotton fibre expressed protein
JGI ISS
UniRef100_B0BLI4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: CM0216.380.nc protein n=1 Tax=Lotus japonicus RepID=B0BLI4_LOTJA
SoyBase E_val: 4.00E-27 ISS
UniRef100_I1K756 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K756_SOYBN
SoyBase E_val: 3.00E-174 ISS
Expression Patterns of Glyma06g01300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g01300
Paralog Evidence Comments
Glyma04g01260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g01300 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g010900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g01300
Coding sequences of Glyma06g01300
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g01300.1 sequence type=CDS gene model=Glyma06g01300 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGTACTCGACCAACTTCCACAAGCTCCAAACAAAGAAACCCACAAAACCTAGGAAACATCATCGTCAGCTCCGAAAGATCGCAAGCTTGTTGCGGTACGCAGAGGTGTGCGTCGTTCTGGTCTTGGTCTCGAGGCTCTCCATCAACCTACCCTCCACTCTCAAAAACACAACCGAGTGTTTCCGCAACTTCATGGGTAGCCCTCGCTTTGTTTTTCTCCTCGGAAACGTCATAATCATAACGTTGTTCGCACAATCGGGACAATTTTCATCTAATCACTCATCTTCAGCCAAACATGCCCCACCGGAACCTGCAGATCTCTATCTCGAGTTCCTCCAAAACACCACCATCCATCAGAAACTTCAACTCCATCTCAGCAACAATAATCGCAAACCAAAGCCAAGTGTGAGACTAGTGGCCGAGACTGTTATAATAAAGGGTCAAGAAATTGATGCCACCAAAACTGCAGAGACTAGTTTGGAGATGAACAAGAAGGATTATAGAAGGTGTCAATCGGATATTATTGTAAAGCGCGTGGAGACTGAGAAGCTTCCTCCGCGCGTGTTGCAGAGGTGTGAGACTCAGAAAGTGCAGGTTAACAATAATAATTCGTACCCTGAAGATGGCATGAGCAACGATGACTTTCGTCGCAAGGTTGAGGCTTTCATTGCTCGCCAACAGAGGCTACGAACTACTCAACTCTCTAATTAA
Predicted protein sequences of Glyma06g01300
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g01300.1 sequence type=predicted peptide gene model=Glyma06g01300 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEYSTNFHKLQTKKPTKPRKHHRQLRKIASLLRYAEVCVVLVLVSRLSINLPSTLKNTTECFRNFMGSPRFVFLLGNVIIITLFAQSGQFSSNHSSSAKHAPPEPADLYLEFLQNTTIHQKLQLHLSNNNRKPKPSVRLVAETVIIKGQEIDATKTAETSLEMNKKDYRRCQSDIIVKRVETEKLPPRVLQRCETQKVQVNNNNSYPEDGMSNDDFRRKVEAFIARQQRLRTTQLSN*