SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g01293

Feature Type:gene_model
Chromosome:Gm06
Start:824941
stop:825851
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g01293
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G19640AT Annotation by Michelle Graham. TAIR10: jasmonic acid carboxyl methyltransferase | chr1:6789166-6791708 REVERSE LENGTH=389 SoyBaseE_val: 3.00E-32ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009694GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid metabolic process SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
GO:0030795GO-mf Annotation by Michelle Graham. GO Molecular Function: jasmonate O-methyltransferase activity SoyBaseN/AISS
PF03492PFAM SAM dependent carboxyl methyltransferase JGI ISS
UniRef100_G7KYA2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Jasmonate O-methyltransferase n=2 Tax=Medicago truncatula RepID=G7KYA2_MEDTR SoyBaseE_val: 3.00E-53ISS
UniRef100_I1K755UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K755_SOYBN SoyBaseE_val: 1.00E-124ISS

Expression Patterns of Glyma06g01293
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g01293 not represented in the dataset
Glyma06g01293 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g01293
ParalogEvidenceComments
Glyma04g01252 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g01293 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g01293
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g01293
>Glyma06g01293.1   sequence type=CDS   gene model=Glyma06g01293   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACGCCCGGAAGCTTTTATGGGAGACTCTTCCCTAGCAATTCCACCAGTCTTCATTGGCTCTCTCAGGCTCCAAAGGGGAAACATTTACTTCACAAACACGAGCCCATCCGAAGTGTACCAAGCATACCTTGACCAGTTTAGTCCATATTTCAATCTGTTTCTAAAATCACGCGCGGAGGAATTATTGCGTGGTGGTGGCATGGTTCTAAGATTTGTTGGTAGAGATGAAACTTTTGACATAATAACTCCTTGGGGGTTAATTGGTTTGGTTCTCATTGACATGGTTTCAGAGAGTTTGATTGAAGAGGCTAAGTTGGAGTGTGTTAATATGCCAAGATATGGTCTTACTGCTAAGAAAGTTAAGCAATTGATTGGTGCAGAAGGGTCTTTCACTCTTGAGAAGTTGGAGACATTCAAGTCGCGTTGGGATGACGGTTTGAAGGAGAATGGTAATGGTGATTTCGTATTAGATACTAATGTCAGAGCCAAATTCATCGCCAAATATGTGAGAGCTACTACTGAACCTTTTATGACGGCACGGTTTGGAGAAGGAATAATTGATGAATTATTTCCTAAATACAGAAACAAGGTTGCGGAACTGTTGGAAGAAGTGATATTAGAGCATGCTTACCTGGTCATGTTTATGACAAAAAAATGA
Predicted protein sequences of Glyma06g01293
>Glyma06g01293.1   sequence type=predicted peptide   gene model=Glyma06g01293   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQRPEAFMGDSSLAIPPVFIGSLRLQRGNIYFTNTSPSEVYQAYLDQFSPYFNLFLKSRAEELLRGGGMVLRFVGRDETFDIITPWGLIGLVLIDMVSESLIEEAKLECVNMPRYGLTAKKVKQLIGAEGSFTLEKLETFKSRWDDGLKENGNGDFVLDTNVRAKFIAKYVRATTEPFMTARFGEGIIDELFPKYRNKVAELLEEVILEHAYLVMFMTKK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo