SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g01240

Feature Type:gene_model
Chromosome:Gm06
Start:789489
stop:790634
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g01240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34590AT Annotation by Michelle Graham. TAIR10: G-box binding factor 6 | chr4:16522449-16522928 FORWARD LENGTH=159 SoyBaseE_val: 1.00E-36ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009410GO-bp Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0017148GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of translation SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0080149GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose induced translational repression SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046982GO-mf Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PTHR22952Panther CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED JGI ISS
PTHR22952:SF60Panther SUBFAMILY NOT NAMED JGI ISS
PF07716PFAM Basic region leucine zipper JGI ISS
UniRef100_Q0GPF9UniRef Annotation by Michelle Graham. Most informative UniRef hit: BZIP transcription factor bZIP123 n=1 Tax=Glycine max RepID=Q0GPF9_SOYBN SoyBaseE_val: 2.00E-95ISS
UniRef100_Q0GPF9UniRef Annotation by Michelle Graham. Best UniRef hit: BZIP transcription factor bZIP123 n=1 Tax=Glycine max RepID=Q0GPF9_SOYBN SoyBaseE_val: 2.00E-95ISS

Expression Patterns of Glyma06g01240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g01240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g01240
ParalogEvidenceComments
Glyma04g01210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g01240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g010200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g01240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g01240
>Glyma06g01240.1   sequence type=CDS   gene model=Glyma06g01240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTATGGCTTGTTCAAGTGGAACATCTTCAGGGACGTCGTCGGAGCTGCAGGGTATGATGGATCAGAGGAAGAGGAAGAGAATGATATCGAACCGCGAATCGGCAAGGCGATCTCGAATGAGGAAGCAGAAGCACTTGGATGATCTAGCATCGCAGCTGACTCAGCTCAGGAGCCAGAATCAGCAGCTTCTCACGTCTGTGAACCTCACCAGCCACAAGTACTTGGCGGTGGAGGCTGAGAACTCTGTTTTGAGAGCACAAGTGAACGAGCTCAGCCACAGGTTGGACTCTCTCAACCAGATCATCCACTTGTTGAATTTCTTTGAGCCCGATGCTAGTACTAGTACCTTCTTCAACAACCCTTTCAATTTCAGCCTCCCGATTATGGCTTCAGCAGACATGTTGCAGTACTGA
Predicted protein sequences of Glyma06g01240
>Glyma06g01240.1   sequence type=predicted peptide   gene model=Glyma06g01240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTMACSSGTSSGTSSELQGMMDQRKRKRMISNRESARRSRMRKQKHLDDLASQLTQLRSQNQQLLTSVNLTSHKYLAVEAENSVLRAQVNELSHRLDSLNQIIHLLNFFEPDASTSTFFNNPFNFSLPIMASADMLQY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo