Report for Sequence Feature Glyma06g01233
Feature Type: gene_model
Chromosome: Gm06
Start: 773021
stop: 773492
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g01233
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
PF00304 PFAM
Gamma-thionin family
JGI ISS
UniRef100_G7J7Q0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Defensin n=1 Tax=Medicago truncatula RepID=G7J7Q0_MEDTR
SoyBase E_val: 2.00E-24 ISS
UniRef100_G7J7Q0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Defensin n=1 Tax=Medicago truncatula RepID=G7J7Q0_MEDTR
SoyBase E_val: 2.00E-24 ISS
Expression Patterns of Glyma06g01233
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g01233
Paralog Evidence Comments
Glyma04g01196 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g01233 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g010100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g01233
Coding sequences of Glyma06g01233
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g01233.1 sequence type=CDS gene model=Glyma06g01233 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTTAGGTTTCTTAAGCGTATTCAAGTCTTCGCGGCTTTTTTGGCCATCATTGTCCTTGTAACCTCAGGCAACAGTAAAACGTGGCCCCATGCAAGATGCTTCCATTCTTCAATTTGCAGTCATCACTGCCAGCCCTCAGAAAATGCAATCTCAGGGCAATGTGTTTTCTTCTTCAAGAAATGCAAATGCAAATTCTGA
Predicted protein sequences of Glyma06g01233
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g01233.1 sequence type=predicted peptide gene model=Glyma06g01233 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVRFLKRIQVFAAFLAIIVLVTSGNSKTWPHARCFHSSICSHHCQPSENAISGQCVFFFKKCKCKF*