SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g01087

Feature Type:gene_model
Chromosome:Gm06
Start:647212
stop:652583
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g01087
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75560AT Annotation by Michelle Graham. TAIR10: zinc knuckle (CCHC-type) family protein | chr1:28371420-28372717 REVERSE LENGTH=257 SoyBaseE_val: 5.00E-95ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG4400 KOG E3 ubiquitin ligase interacting with arginine methyltransferase JGI ISS
PTHR23002Panther ZINC FINGER CCHC DOMAIN CONTAINING PROTEIN JGI ISS
PF00098PFAM Zinc knuckle JGI ISS
UniRef100_D3YBE9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Zinc knuckle (CcHc-type) family protein n=1 Tax=Trifolium repens RepID=D3YBE9_TRIRP SoyBaseE_val: 9.00E-148ISS
UniRef100_UPI000233975FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233975F related cluster n=1 Tax=unknown RepID=UPI000233975F SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g01087
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g01087 not represented in the dataset
Glyma06g01087 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g01087
ParalogEvidenceComments
Glyma04g01078 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g01087 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g008500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g01087
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g01087
>Glyma06g01087.1   sequence type=CDS   gene model=Glyma06g01087   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTCAGACAGCCGCAGCAGGAGCAGGAGCAGAAGCAGGAGCCCAATGGACCGTAAGATCCGCTCTGATCGATTTTCCTATCGAGATGCACCTTACAGGAGAGATTCACGTCGGGGTTTCAGCCGAGACAATCTGTGCAAGAACTGCAAGAGGCCTGGTCATTATGCAAGAGAATGCCCGAATGTTGCAATTTGCCACAACTGTGGCCTCCCTGGGCACATTGCTTCTGAATGTACCACAAAGTCGCTGTGCTGGAACTGTAAAGAACCTGGCCACATGGCCAGCAGTTGTCCAAATGAGGGCATTTGCCACACCTGTGGTAAAGCTGGACACCGTGCTAGGGAATGCTCAGCCCCTCCAATGCCTCCAGGGGACTTGAGGTTGTGCAACAACTGTTATAAGCAGGGGCACATTGCCGCGGAATGTACGAATGAGAAGGCTTGCAACAACTGTAGGAAGACAGGCCACTTGGCACGTGATTGTCCTAACGATCCAATTTGTAATTTGTGCAATGTTTCTGGGCATGTGGCTAGACAGTGTCCGAAAGCCAATGTTCTTGGAGACCGCAGTGGTGGCGGTGGTGGCGGCGGCGGTGCTCGTGGTGGCGGCGGCGGTGGCTACCGAGATGTTGTTTGCAGGAACTGCCAGCAATTAGGTCACATGAGTAGGGATTGCATGGGCCCCTTGATGATTTGTCACAATTGTGGAGGTCGTGGTCACCTGGCATATGAGTGCCCTTCGGGTCGGTTTATGGACCGCTACCCCAGGAGGTACTGA
Predicted protein sequences of Glyma06g01087
>Glyma06g01087.1   sequence type=predicted peptide   gene model=Glyma06g01087   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSDSRSRSRSRSRSPMDRKIRSDRFSYRDAPYRRDSRRGFSRDNLCKNCKRPGHYARECPNVAICHNCGLPGHIASECTTKSLCWNCKEPGHMASSCPNEGICHTCGKAGHRARECSAPPMPPGDLRLCNNCYKQGHIAAECTNEKACNNCRKTGHLARDCPNDPICNLCNVSGHVARQCPKANVLGDRSGGGGGGGGARGGGGGGYRDVVCRNCQQLGHMSRDCMGPLMICHNCGGRGHLAYECPSGRFMDRYPRRY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo