SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g01030

Feature Type:gene_model
Chromosome:Gm06
Start:600696
stop:602945
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g01030
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34700AT Annotation by Michelle Graham. TAIR10: LYR family of Fe/S cluster biogenesis protein | chr4:16556874-16558362 FORWARD LENGTH=117 SoyBaseE_val: 5.00E-56ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0031966GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial membrane SoyBaseN/AISS
GO:0045271GO-cc Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
PTHR12868Panther NADH-UBIQUINONE OXIDOREDUCTASE B22 SUBUNIT JGI ISS
UniRef100_G7J7T5UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase n=1 Tax=Medicago truncatula RepID=G7J7T5_MEDTR SoyBaseE_val: 5.00E-62ISS
UniRef100_I1K725UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K725_SOYBN SoyBaseE_val: 3.00E-85ISS

Expression Patterns of Glyma06g01030
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g01030
ParalogEvidenceComments
Glyma04g01000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g01030 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g007900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g01030
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g01030
>Glyma06g01030.1   sequence type=CDS   gene model=Glyma06g01030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCGACGGCAGCGTACCTTGCTCGGCGCGCGGCGCAGAAGGAGAGGGTTCGGATCCTCTACCGCCGCGCCCTCAAAGACACTCTCAACTGGGCCGTACATCGCCACCTCTTCTACGACGACGCTTCAAACCTCCGCGAAAGGTTCGAGGAGAACAGACACGTGGAAGACCCTGATACCATTGACAGGCTCATAACGGATGCTGAAGCTTCCTACAACAAGTGGCGCCATCCCGATCCCTATATTGTTCCTTGGGCTCCTGGTGGTTCCAAGTTTACTCGCAACCCAACTCCACCTCAAGGGGTAAGTTGTTATGGTTATATCATACGCTTATCTTTTCCATTTTTTGTTGGTCCTACTTATTGA
Predicted protein sequences of Glyma06g01030
>Glyma06g01030.1   sequence type=predicted peptide   gene model=Glyma06g01030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTAAYLARRAAQKERVRILYRRALKDTLNWAVHRHLFYDDASNLRERFEENRHVEDPDTIDRLITDAEASYNKWRHPDPYIVPWAPGGSKFTRNPTPPQGVSCYGYIIRLSFPFFVGPTY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo