Glyma06g01000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g01000

Feature Type:	gene_model
Chromosome:	Gm06
Start:	590649
stop:	593432
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g01000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G21270	AT	Annotation by Michelle Graham. TAIR10: ubiquitin fusion degradation 1 \| chr2:9108126-9110012 FORWARD LENGTH=319	SoyBase	E_val: 3.00E-83	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1816	KOG	Ubiquitin fusion-degradation protein	JGI		ISS
PTHR12555	Panther	UBIQUITIN FUSION DEGRADATON PROTEIN 1	JGI		ISS
PF03152	PFAM	Ubiquitin fusion degradation protein UFD1	JGI		ISS
UniRef100_G7LAK8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin fusion degradation protein n=1 Tax=Medicago truncatula RepID=G7LAK8_MEDTR	SoyBase	E_val: 3.00E-95	ISS
UniRef100_I1K724	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K724_SOYBN	SoyBase	E_val: 2.00E-158	ISS

Expression Patterns of Glyma06g01000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g01000

Paralog	Evidence	Comments
Glyma04g00980	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g01000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g007600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g01000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g01000

Limit To All Plant Sequences

>Glyma06g01000.2   sequence type=CDS   gene model=Glyma06g01000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTTTGACGGATACGGGTATCAAGGGACATCATCATTTGAGCAGACATTTCGATGTTACTCTGCTTCATTTATTGAAAAGCCCGAAATTGAAAATGGTGATAAAATTATAGTTCCTCCTTCAGTCCTTGACCGTCTAGCATTTCTACGTATTGATTATCCTATGATGTTTAAACTCAGAAATGGTGCTTCAATTCTGAGCGGGTTTCTCATTATGATGCAGAATATGCTTTTGCAAGAGGGAGACACCGTAAGACTGAAATATGTATCACTTCCAAGGGGAACATTTGTTAAATTACAGCCCCAAACAAAGGACTTTTTTGATATTTCCAATCCAAAAGCTATTTACGTCAATTCAGTCATGAGCTTATGCATGGGCCTCGTTATAGTGGATACTATCATGGTGACATACAACAACAAAAAGTATTACTTAGATGTTATAGAAACAAAGCCTGCTAATGCTATAAGCATCATCGAGACAGACTGTGAGGTGGACTTTGCTCCTTCCTTGGATTACAAGTTCAACCCATTTTTTGGGACTGGGAGACGCTTAGATGGAAACTCAATTCCTCCTGTTTATTCTTCACGGCCTTCTGATGTTCCAAATGTCAATTCATTGTCTTTTACAAATTCTAGTTCACCAAATTTCGCTCGTCCATCTCAGGGAAAGCTAGAGAAAAGACCGAGTCAAAACAAGAGGCACCCCAAATTTCAGCCTTTCACTGGGAAGAAGTATTCCCTAAGGATATAA

Predicted protein sequences of Glyma06g01000

Limit To All Plant Sequences

>Glyma06g01000.2   sequence type=predicted peptide   gene model=Glyma06g01000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFFDGYGYQGTSSFEQTFRCYSASFIEKPEIENGDKIIVPPSVLDRLAFLRIDYPMMFKLRNGASILSGFLIMMQNMLLQEGDTVRLKYVSLPRGTFVKLQPQTKDFFDISNPKAIYVNSVMSLCMGLVIVDTIMVTYNNKKYYLDVIETKPANAISIIETDCEVDFAPSLDYKFNPFFGTGRRLDGNSIPPVYSSRPSDVPNVNSLSFTNSSSPNFARPSQGKLEKRPSQNKRHPKFQPFTGKKYSLRI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain