SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g00980

Feature Type:gene_model
Chromosome:Gm06
Start:556745
stop:559000
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g00980
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34720AT Annotation by Michelle Graham. TAIR10: ATPase, F0/V0 complex, subunit C protein | chr4:16568223-16569165 REVERSE LENGTH=164 SoyBaseE_val: 7.00E-109ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0015991GO-bp Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0033177GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, proton-transporting domain SoyBaseN/AISS
GO:0033179GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting V-type ATPase, V0 domain SoyBaseN/AISS
GO:0015078GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0046961GO-mf Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism SoyBaseN/AISS
KOG0232 KOG Vacuolar H+-ATPase V0 sector, subunits c/c' JGI ISS
PTHR10263Panther VACUOLAR ATP SYNTHASE PROTEOLIPID SUBUNIT JGI ISS
PF00137PFAM ATP synthase subunit C JGI ISS
UniRef100_I1JCJ3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JCJ3_SOYBN SoyBaseE_val: 1.00E-107ISS
UniRef100_O22552UniRef Annotation by Michelle Graham. Most informative UniRef hit: V-type proton ATPase 16 kDa proteolipid subunit n=1 Tax=Vigna radiata var. radiata RepID=VATL_VIGRR SoyBaseE_val: 3.00E-107ISS

Expression Patterns of Glyma06g00980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g00980
ParalogEvidenceComments
Glyma04g00950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g00980 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g007400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g00980
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g00980
>Glyma06g00980.1   sequence type=CDS   gene model=Glyma06g00980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCCTTCAGCGGTGATGAAACGGCACCGTTTTTCGGCTTCCTTGGCGCCGCAGCTGCCCTCGTCTTCTCCTGTATGGGAGCTGCCTATGGCACAGCGAAGAGTGGCGTGGGCGTGGCTTCCATGGGTGTAATGAGACCTGAGCTGGTGATGAAGTCGATTGTTCCTGTTGTCATGGCTGGAGTTTTGGGTATTTATGGCCTTATTATTGCTGTTATTATCAGTACCGGTATTAATCCAAAGGCCAAATCCTATTACCTCTTTGATGGTTATGCACATCTCTCTTCTGGTCTTGCCTGTGGCTTGGCTGGCCTTTCTGCTGGCATGGCTATTGGTATTGTTGGTGATGCCGGTGTTAGAGCCAATGCACAACAACCAAAACTTTTTGTTGGAATGATTCTCATCCTCATTTTTGCTGAAGCACTTGCCCTTTATGGTCTCATTGTTGGTATTATCCTGTCTTCTCGTGCTGGCCAGTCTAGAGCCGACTAA
Predicted protein sequences of Glyma06g00980
>Glyma06g00980.1   sequence type=predicted peptide   gene model=Glyma06g00980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo