SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g00831

Feature Type:gene_model
Chromosome:Gm06
Start:485619
stop:486437
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g00831
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34800AT Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr4:16596860-16597144 FORWARD LENGTH=94 SoyBaseE_val: 9.00E-31ISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02519PFAM Auxin responsive protein JGI ISS
UniRef100_G7JMC3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced SAUR-like protein n=1 Tax=Medicago truncatula RepID=G7JMC3_MEDTR SoyBaseE_val: 2.00E-45ISS
UniRef100_I1JSH1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSH1_SOYBN SoyBaseE_val: 1.00E-53ISS

Expression Patterns of Glyma06g00831
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g00831 not represented in the dataset
Glyma06g00831 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g00831
ParalogEvidenceComments
Glyma04g00820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g00831 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g006000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g00831
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g00831
>Glyma06g00831.1   sequence type=CDS   gene model=Glyma06g00831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTTCAAGTGCACGCTCCAACAATTAATATCCACTTCAGTCTTCAACACCTTGCACAATTCCTATAATCAGATCAGATCAAAATCACATTATACATATATGGGTATTCGTCTGCCAATATTCATGGCTCTTCATGCTAACAAGATATTCAAGTGGCAGCAGCATCTCCATAGTAGAAACCACTCGAATGTTCCAAAGGGTCACATAGTAGTGTATGTTGGAGAGGCTCAAAAGAAGAGGTTTGTGGTTCCAATATCTTACTTGAACCATCCTTCGTTTGTTGACTTGCTAAACCGAGTCGTGGAAGAATTTGGCTACAATCATCCAATGGGCGGTCTCACTATCCCTTGCAAAGAAGAGGCATTCATCACTCTCACCTCTCAACTACGTGCCTCCTGA
Predicted protein sequences of Glyma06g00831
>Glyma06g00831.1   sequence type=predicted peptide   gene model=Glyma06g00831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIFKCTLQQLISTSVFNTLHNSYNQIRSKSHYTYMGIRLPIFMALHANKIFKWQQHLHSRNHSNVPKGHIVVYVGEAQKKRFVVPISYLNHPSFVDLLNRVVEEFGYNHPMGGLTIPCKEEAFITLTSQLRAS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo