Report for Sequence Feature Glyma06g00750
Feature Type: gene_model
Chromosome: Gm06
Start: 434516
stop: 434849
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g00750
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_C6TCC8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TCC8_SOYBN
SoyBase E_val: 3.00E-39 ISS
Expression Patterns of Glyma06g00750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma06g00750
Paralog Evidence Comments
Glyma04g00730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g00750 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g005200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g00750
Coding sequences of Glyma06g00750
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g00750.2 sequence type=CDS gene model=Glyma06g00750 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGCTATGGTAGAAGCAGAGCATCCTCTGTTTTGGACGGTTTCACTCTAAACCCCGTGCCATACCCGGTTATGCTAATCTTATCACTGATCCTGTTATTCCTCGGCATTTCGGGGTGGATGCTGTTAGCCACACCAGTGGTGCTTATACTCGTAGTTCGTTGGTTATCGTCAGTGTATACTTCAGAATGGTTCTTCTTTAACTCCTTGCCATTGGAGAGGCGTAGGAGAACTCACCACTTCCCATCAGAGGCTCCCCTCGGGGTGTTGCTGCTTGTTCTCGTGCTTCTTCATTTTCAGTCCACTTTTCTTGATGCATGGTTTGTTTGA
Predicted protein sequences of Glyma06g00750
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g00750.2 sequence type=predicted peptide gene model=Glyma06g00750 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGYGRSRASSVLDGFTLNPVPYPVMLILSLILLFLGISGWMLLATPVVLILVVRWLSSVYTSEWFFFNSLPLERRRRTHHFPSEAPLGVLLLVLVLLHFQSTFLDAWFV*