Glyma06g00671 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g00671

Feature Type:	gene_model
Chromosome:	Gm06
Start:	370698
stop:	371685
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g00671

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G34950	AT	Annotation by Michelle Graham. TAIR10: Major facilitator superfamily protein \| chr4:16642544-16644759 REVERSE LENGTH=567	SoyBase	E_val: 6.00E-48	ISS
GO:0007623	GO-bp	Annotation by Michelle Graham. GO Biological Process: circadian rhythm	SoyBase	N/A	ISS
GO:0019761	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
PTHR21576	Panther	UNCHARACTERIZED NODULIN-LIKE PROTEIN	JGI		ISS
PTHR21576:SF12	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_B9DH66	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT4G34950 protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B9DH66_ARATH	SoyBase	E_val: 3.00E-47	ISS
UniRef100_C6TCW5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TCW5_SOYBN	SoyBase	E_val: 7.00E-57	ISS

Expression Patterns of Glyma06g00671

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g00671 not represented in the dataset	Glyma06g00671 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g00671

Paralog	Evidence	Comments
Glyma04g00600	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g00671 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g004300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g00671

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g00671

Limit To All Plant Sequences

>Glyma06g00671.1   sequence type=CDS   gene model=Glyma06g00671   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTATGCCAGGTTCCCTTTACATATGGTCCATTGTGGTTGGCATATGCTATGCGGTGCCGCTTGCCATTACTCTGCCAACTGCCTCGGAGTTATTTGGCCTCAAATATTATGGTCTTATATACAACATTCTCATTTTTAACCTTCCCTTTGGTTCTTTCCTCTTTTCTGGTCTCCTTGCTGGCATTCTCTATGATTTGGAGGCAACTACCACCGCAGGAGGAGGCGACACTTGTGTTGGAGCTCATTGTTACAGACTAGTATTCATAATCATGGCTGCAGCTTGTGTTGTTGGCTTCTTCTTAGACTTTTTTTTTGTCATTCAGAAGTAA

Predicted protein sequences of Glyma06g00671

Limit To All Plant Sequences

>Glyma06g00671.1   sequence type=predicted peptide   gene model=Glyma06g00671   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMPGSLYIWSIVVGICYAVPLAITLPTASELFGLKYYGLIYNILIFNLPFGSFLFSGLLAGILYDLEATTTAGGGDTCVGAHCYRLVFIIMAAACVVGFFLDFFFVIQK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain