Report for Sequence Feature Glyma06g00650
Feature Type: gene_model
Chromosome: Gm06
Start: 363388
stop: 365884
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g00650
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G34960 AT
Annotation by Michelle Graham. TAIR10: Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein | chr4:16648865-16650646 FORWARD LENGTH=224
SoyBase E_val: 2.00E-86 ISS
GO:0006457 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein folding
SoyBase N/A ISS
GO:0005768 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endosome
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0005802 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network
SoyBase N/A ISS
GO:0003755 GO-mf
Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity
SoyBase N/A ISS
KOG0880
KOG
Peptidyl-prolyl cis-trans isomerase
JGI ISS
PTHR11071 Panther
CYCLOPHILIN
JGI ISS
PTHR11071:SF57 Panther
PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (CYCLOPHILIN)
JGI ISS
PF00160 PFAM
Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
JGI ISS
UniRef100_I3S543 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Medicago truncatula RepID=I3S543_MEDTR
SoyBase E_val: 6.00E-97 ISS
UniRef100_UPI000233AA54 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233AA54 related cluster n=1 Tax=unknown RepID=UPI000233AA54
SoyBase E_val: 4.00E-128 ISS
Expression Patterns of Glyma06g00650
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma06g00650
Paralog Evidence Comments
Glyma04g00580 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma06g00650 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma06g00650
Coding sequences of Glyma06g00650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g00650.2 sequence type=CDS gene model=Glyma06g00650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCATAGAGCGATCTCGTTCTTCGTTCAACCGCGATGCCTCCTTCTCATAGGTGTTCTCTCAATTTTCTTGATTCTCGCATTATCGGGTACCAAATGGGTTGAAGAGAAAGAAGAACAACCTGAAATTACAGACAGAGTATTCTTTGATGTTGATATTGATGGACAACGTTTAGGTAGGATTGTCATTGGATTGTATGGCCAAGTTGTACCAAAAACTGTGGGTTTCATGATTCAGGGCGGAGATATTGTTCATCATGATGGTAGAGGATACGAATCTATTTATGGTGGCACCTTTCCTGATGAGAATTTCAAGATAAAACATTCACATGCTGGTGTAGTCTCTATGGTGAATTCAGGTCCCGATTACAATGGCTCACAGTTTTTTATTACCACAGTGAAGACCGGTTGGTTAGATGGAGAACATGGTGTGTTTGGCAAGGTTGTCCAAGGCATGGATTCTGTGTTTGCAATTGAAGGAGGTGCTGGAACCTACAATGGGAAACCCAGAAAGAAGGTAGTGATTGCAGACTCTGGAGAGATACCCAAGAGTCAGTGGGATAAGGAAAGATGA
Predicted protein sequences of Glyma06g00650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g00650.2 sequence type=predicted peptide gene model=Glyma06g00650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MHRAISFFVQPRCLLLIGVLSIFLILALSGTKWVEEKEEQPEITDRVFFDVDIDGQRLGRIVIGLYGQVVPKTVGFMIQGGDIVHHDGRGYESIYGGTFPDENFKIKHSHAGVVSMVNSGPDYNGSQFFITTVKTGWLDGEHGVFGKVVQGMDSVFAIEGGAGTYNGKPRKKVVIADSGEIPKSQWDKER*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
