SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g00510

Feature Type:gene_model
Chromosome:Gm06
Start:229125
stop:231343
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48730AT Annotation by Michelle Graham. TAIR10: glutamate-1-semialdehyde 2,1-aminomutase 2 | chr3:18049697-18051550 FORWARD LENGTH=472 SoyBaseE_val: 0ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006779GO-bp Annotation by Michelle Graham. GO Biological Process: porphyrin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009073GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0033014GO-bp Annotation by Michelle Graham. GO Biological Process: tetrapyrrole biosynthetic process SoyBaseN/AISS
GO:0045036GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008483GO-mf Annotation by Michelle Graham. GO Molecular Function: transaminase activity SoyBaseN/AISS
GO:0030170GO-mf Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding SoyBaseN/AISS
GO:0042286GO-mf Annotation by Michelle Graham. GO Molecular Function: glutamate-1-semialdehyde 2,1-aminomutase activity SoyBaseN/AISS
KOG1401 KOG Acetylornithine aminotransferase JGI ISS
PTHR11986Panther AMINOTRANSFERASE CLASS III JGI ISS
PTHR11986:SF5Panther GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE JGI ISS
PF00202PFAM Aminotransferase class-III JGI ISS
UniRef100_P45621UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic n=1 Tax=Glycine max RepID=GSA_SOYBN SoyBaseE_val: 0ISS
UniRef100_P45621UniRef Annotation by Michelle Graham. Best UniRef hit: Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic n=1 Tax=Glycine max RepID=GSA_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g00420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g002900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g00510.1   sequence type=CDS   gene model=Glyma06g00510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGTTTCGGCTATCACTGGAGCGAGGCTAACTCTAGGGATGTCTCTTTCCTCTTCCACGCGATCACGAACCGTCGCAATGGCCGTATCTATCGACCCCAAGACCGATAACAAACTCACTCTTACCAAGTCCGAGGAAGCTTTCGCTGCGGCCAAGGAGCTGATGCCTGGAGGCGTGAACTCCCCAGTTCGTGCCTTCAAATCCGTGGGTGGTCAACCAATTGTGATTGATTCAGTCAAAGGGTCTCGTATGTGGGATATCGATGGCAATGAGTACATTGACTACGTTGGTTCCTGGGGTCCTGCAATCATTGGTCACGCTGATGATCAGGTGCTTGCAGCTCTGGGTGAAACCATGAAGAAAGGAACCAGCTTTGGTGCACCCTGTCTGCTGGAAAACACTTTGGCAGAGCTGGTTATCGATGCCGTCCCCAGCATTGAAATGGTTCGGTTTGTCAATTCAGGCACTGAAGCTTGCATGGGTGCGCTCCGTCTGGCCCGTGCTTATACCGGAAGAGAGAAGATCATCAAGTTTGAGGGCTGTTACCATGGCCATGCTGATCCTTTTCTTGTTAAGGCAGGTAGTGGAGTTGCCACCTTAGGACTTCCTGATTCTCCCGGTGTCCCCAAAGCTGCCACTTTTGAAACCCTTACAGCCCCCTACAATGACACCGAGGCCATTGAGAAACTCTTCGAGGCCAACAAAGGAGAAATTGCCGCAGTTTTCCTCGAACCTGTTGTTGGAAACGCTGGTTTCATTGTTCCTAAGCCTGATTTTCATAGTTTCTTGCGCAAGATCACCAAGGAGAACAATACCCTTCTTGTGTTTGATGAAGTCATGACTGGATTTCGTTTGTCATATGGAGGTGCTCAAGAGTATTTTGGCATAACTCCAGATATAACAACTCTAGGAAAGATCATTGGTGGAGGTCTGCCGGTAGGCGCTTATGGAGGGAGGAGGGATATTATGGAGAAGGTGGCACCAGCTGGCCCAATGTATCAGGCTGGGACCTTGAGTGGGAACCCTTTGGCCATGACTGCAGGCATAGAGACCCTGCAGCGTATTAAGGAGCCAGGAACTTACGAGTACTTGGACAAAATCACTGGTGAGCTTGTTGAGGGCATCATCGAAGCTGGGAAGCGGGCAGGCCATGCAATATGTGGTGGGCATATAAGGGGGATGTTTGGGTTTTTCTTCACAGAAGGACCAGTGTATAATTTTGCAGATGCCAAAAAGAGTGATACGGCCAAGTTTGCTAGGTTCTTTTGGGGAATGCTGGCGGAAGGTGTCTATTTGGCACCTTCCCAGTTTGAGGCTGGCTTCACCAGCTTGGCACATACTTCTGATGACATAAAAAAGACGATAGCCGCTGCTGAGAAGGTTTTCAGGGAGATCTGA

>Glyma06g00510.1   sequence type=predicted peptide   gene model=Glyma06g00510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVSAITGARLTLGMSLSSSTRSRTVAMAVSIDPKTDNKLTLTKSEEAFAAAKELMPGGVNSPVRAFKSVGGQPIVIDSVKGSRMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENTLAELVIDAVPSIEMVRFVNSGTEACMGALRLARAYTGREKIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKAATFETLTAPYNDTEAIEKLFEANKGEIAAVFLEPVVGNAGFIVPKPDFHSFLRKITKENNTLLVFDEVMTGFRLSYGGAQEYFGITPDITTLGKIIGGGLPVGAYGGRRDIMEKVAPAGPMYQAGTLSGNPLAMTAGIETLQRIKEPGTYEYLDKITGELVEGIIEAGKRAGHAICGGHIRGMFGFFFTEGPVYNFADAKKSDTAKFARFFWGMLAEGVYLAPSQFEAGFTSLAHTSDDIKKTIAAAEKVFREI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo