SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g00450

Feature Type:gene_model
Chromosome:Gm06
Start:204673
stop:206805
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g00450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G38110AT Annotation by Michelle Graham. TAIR10: anti- silencing function 1b | chr5:15208643-15210064 FORWARD LENGTH=218 SoyBaseE_val: 1.00E-103ISS
GO:0000724GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination SoyBaseN/AISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009294GO-bp Annotation by Michelle Graham. GO Biological Process: DNA mediated transformation SoyBaseN/AISS
GO:0010091GO-bp Annotation by Michelle Graham. GO Biological Process: trichome branching SoyBaseN/AISS
GO:0031567GO-bp Annotation by Michelle Graham. GO Biological Process: cell size control checkpoint SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG3265 KOG Histone chaperone involved in gene silencing JGI ISS
PTHR12040Panther ANTI-SILENCING PROTEIN 1 JGI ISS
PF04729PFAM ASF1 like histone chaperone JGI ISS
UniRef100_G7J8L0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone chaperone ASF1B n=1 Tax=Medicago truncatula RepID=G7J8L0_MEDTR SoyBaseE_val: 3.00E-118ISS
UniRef100_I1K6X2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6X2_SOYBN SoyBaseE_val: 2.00E-135ISS

Expression Patterns of Glyma06g00450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g00450
ParalogEvidenceComments
Glyma04g00380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g00450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g002300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g00450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g00450
>Glyma06g00450.1   sequence type=CDS   gene model=Glyma06g00450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGCTGTGAACATCACCAACGTCACCGTCCTGGACAACCCTGCTTCCTTTCTGACCCCCTTTCAGTTCGAGATTTCCTACGAGTGTCTCACCGCTCTCAAAGATGATTTGGAATGGAAGCTCATTTATGTTGGATCTGCTGAGGATGAGACCTATGATCAATTATTAGAGAGTGTCCTTGTTGGTCCTGTCAACGTTGGAAACTATCGTTTTGTTTTACAGGCAGATCCACCAGATCCATCCAAGATTCGTGAAGAAGATATAATTGGTGTCACTGTGCTTCTGTTGACCTGCTCCTATCTGGGTCAGGAATTTATTCGTGTTGGCTATTATGTGAACAATGATTATGATGATGAGCAGCTGAGAGAGGAACCTCCACCAAAGGTTTTAATCGATAGGGTTCAAAGGAACATTTTGTCTGATAAACCAAGGGTCACAAAGTTCCCCATCAATTTCCACCCTGAGAACAATGAAAATGAAGAGCAACAACCCCCTCCATCTGAGCACCCATCGGAAACTGGAGAAGATCCACTTGCTGTAGTTGATCGTGATCCTCCAGATGAGAAGGATTCTTAA
Predicted protein sequences of Glyma06g00450
>Glyma06g00450.1   sequence type=predicted peptide   gene model=Glyma06g00450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAVNITNVTVLDNPASFLTPFQFEISYECLTALKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVLQADPPDPSKIREEDIIGVTVLLLTCSYLGQEFIRVGYYVNNDYDDEQLREEPPPKVLIDRVQRNILSDKPRVTKFPINFHPENNENEEQQPPPSEHPSETGEDPLAVVDRDPPDEKDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo