Glyma06g00426 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g00426): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g00426): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g00426

Feature Type:	gene_model
Chromosome:	Gm06
Start:	169361
stop:	179794
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g00426

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G03250	AT	Annotation by Michelle Graham. TAIR10: UDP-GLUCOSE PYROPHOSPHORYLASE 1 \| chr3:749761-754014 REVERSE LENGTH=469	SoyBase	E_val: 9.00E-68	ISS
GO:0000023	GO-bp	Annotation by Michelle Graham. GO Biological Process: maltose metabolic process	SoyBase	N/A	ISS
GO:0005985	GO-bp	Annotation by Michelle Graham. GO Biological Process: sucrose metabolic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0052543	GO-bp	Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0090406	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: pollen tube	SoyBase	N/A	ISS
GO:0003983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UTP:glucose-1-phosphate uridylyltransferase activity	SoyBase	N/A	ISS
GO:0016779	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotidyltransferase activity	SoyBase	N/A	ISS
PTHR11952	Panther	UDP- GLUCOSE PYROPHOSPHORYLASE	JGI		ISS
PTHR11952:SF1	Panther	UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE	JGI		ISS
PF01704	PFAM	UTP--glucose-1-phosphate uridylyltransferase	JGI		ISS
UniRef100_G7J8L5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: UTP-glucose-1-phosphate uridylyltransferase n=1 Tax=Medicago truncatula RepID=G7J8L5_MEDTR	SoyBase	E_val: 1.00E-77	ISS
UniRef100_I1K6X0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6X0_SOYBN	SoyBase	E_val: 8.00E-128	ISS

Expression Patterns of Glyma06g00426

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g00426 not represented in the dataset	Glyma06g00426 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g00426 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g00426

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g00426

Limit To All Plant Sequences

>Glyma06g00426.1   sequence type=CDS   gene model=Glyma06g00426   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCTTCGGGAGATTGGTGGAGACCAAGATAAACACTTGAAGGACAATTTCAAACTCATCGATACAACAAACATGTGGGTGAGTTTAAGAGCCATCAAGAGGTTTGTTGACACTGTTGAAGTAAGGCAGAAGAAGCCCTCATTTTCAAAGGACACAGCAGCTGGACCAGCAATAAAGTTCTTTGATAATGTATTTGGTGTCTCCGTGCCCGAATCTCGCTTTCTTCCCTTGGATGCAACATCAGATCTATTACTTCTTCAGTCAGATCTATACACTTGTAGAGAAGGTGTTTTAACTCGAAATCCAGCTAGAACTAACCCTTTAAATCCTGTGATAGACTTGGGACCTGAATTTGAAAAGTTTGGTGACTTTCAAAGTCGCTTCAGATCCATTCCAAGCATCATTGAGTTGGACAGTTTGATGGTGAGAGGTGATGTGTGGTTTGGGGCTAATATTACTTTGAAGGGGCAAGTGACTATTGCTGCAAAACCTGGCTTGAAATTGGAAATTCCTGATGGGGTGACGATTGAGAATAAGGAGATCAACGACCCTGCAGATATCTAA

Predicted protein sequences of Glyma06g00426

Limit To All Plant Sequences

>Glyma06g00426.1   sequence type=predicted peptide   gene model=Glyma06g00426   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLREIGGDQDKHLKDNFKLIDTTNMWVSLRAIKRFVDTVEVRQKKPSFSKDTAAGPAIKFFDNVFGVSVPESRFLPLDATSDLLLLQSDLYTCREGVLTRNPARTNPLNPVIDLGPEFEKFGDFQSRFRSIPSIIELDSLMVRGDVWFGANITLKGQVTIAAKPGLKLEIPDGVTIENKEINDPADI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain