SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g00426

Feature Type:gene_model
Chromosome:Gm06
Start:169361
stop:179794
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g00426
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G03250AT Annotation by Michelle Graham. TAIR10: UDP-GLUCOSE PYROPHOSPHORYLASE 1 | chr3:749761-754014 REVERSE LENGTH=469 SoyBaseE_val: 9.00E-68ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0005985GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0052543GO-bp Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0090406GO-cc Annotation by Michelle Graham. GO Cellular Compartment: pollen tube SoyBaseN/AISS
GO:0003983GO-mf Annotation by Michelle Graham. GO Molecular Function: UTP:glucose-1-phosphate uridylyltransferase activity SoyBaseN/AISS
GO:0016779GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotidyltransferase activity SoyBaseN/AISS
PTHR11952Panther UDP- GLUCOSE PYROPHOSPHORYLASE JGI ISS
PTHR11952:SF1Panther UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE JGI ISS
PF01704PFAM UTP--glucose-1-phosphate uridylyltransferase JGI ISS
UniRef100_G7J8L5UniRef Annotation by Michelle Graham. Most informative UniRef hit: UTP-glucose-1-phosphate uridylyltransferase n=1 Tax=Medicago truncatula RepID=G7J8L5_MEDTR SoyBaseE_val: 1.00E-77ISS
UniRef100_I1K6X0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6X0_SOYBN SoyBaseE_val: 8.00E-128ISS

Expression Patterns of Glyma06g00426
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g00426 not represented in the dataset
Glyma06g00426 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g00426 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g00426
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g00426
>Glyma06g00426.1   sequence type=CDS   gene model=Glyma06g00426   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCTTCGGGAGATTGGTGGAGACCAAGATAAACACTTGAAGGACAATTTCAAACTCATCGATACAACAAACATGTGGGTGAGTTTAAGAGCCATCAAGAGGTTTGTTGACACTGTTGAAGTAAGGCAGAAGAAGCCCTCATTTTCAAAGGACACAGCAGCTGGACCAGCAATAAAGTTCTTTGATAATGTATTTGGTGTCTCCGTGCCCGAATCTCGCTTTCTTCCCTTGGATGCAACATCAGATCTATTACTTCTTCAGTCAGATCTATACACTTGTAGAGAAGGTGTTTTAACTCGAAATCCAGCTAGAACTAACCCTTTAAATCCTGTGATAGACTTGGGACCTGAATTTGAAAAGTTTGGTGACTTTCAAAGTCGCTTCAGATCCATTCCAAGCATCATTGAGTTGGACAGTTTGATGGTGAGAGGTGATGTGTGGTTTGGGGCTAATATTACTTTGAAGGGGCAAGTGACTATTGCTGCAAAACCTGGCTTGAAATTGGAAATTCCTGATGGGGTGACGATTGAGAATAAGGAGATCAACGACCCTGCAGATATCTAA
Predicted protein sequences of Glyma06g00426
>Glyma06g00426.1   sequence type=predicted peptide   gene model=Glyma06g00426   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLREIGGDQDKHLKDNFKLIDTTNMWVSLRAIKRFVDTVEVRQKKPSFSKDTAAGPAIKFFDNVFGVSVPESRFLPLDATSDLLLLQSDLYTCREGVLTRNPARTNPLNPVIDLGPEFEKFGDFQSRFRSIPSIIELDSLMVRGDVWFGANITLKGQVTIAAKPGLKLEIPDGVTIENKEINDPADI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo