Glyma06g00420 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g00420

Feature Type:	gene_model
Chromosome:	Gm06
Start:	167177
stop:	168467
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g00420

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G43030	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L3 family protein \| chr2:17894898-17895713 FORWARD LENGTH=271	SoyBase	E_val: 4.00E-131	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3141	KOG	Mitochondrial/chloroplast ribosomal protein L3	JGI		ISS
PTHR11229	Panther	50S RIBOSOMAL PROTEIN L3	JGI		ISS
PF00297	PFAM	Ribosomal protein L3	JGI		ISS
UniRef100_G7J8L6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L3 n=1 Tax=Medicago truncatula RepID=G7J8L6_MEDTR	SoyBase	E_val: 2.00E-144	ISS
UniRef100_I1K6W9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6W9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g00420

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g00420

Paralog	Evidence	Comments
Glyma04g00360	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g00420 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g001800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g00420

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g00420

Limit To All Plant Sequences

>Glyma06g00420.1   sequence type=CDS   gene model=Glyma06g00420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGATCTTGTCCGTTCCGTCACCAACACAGCGTTGTTCCATTTCGATTTCTCGGCTGCCATTGCCATTGCCATTGCCGTTTCAATTGCAAGTAAGAAGAAGAGCAAAAGGGGGAAAAGTGGTAATGAGCATGGAGGCAGGTATTGGAGTGATGGGCACCAAGTTGGGTATGATGAGCTATTTCGAATCCGACGGAGAGGTTGTTCCTGTCACTGTCGTGGGTTTCAAAGAAGGCAACATCGTCACCCAGATCAAAACTGAGGCCACCGATGGATACGACGCCGTCCAGGTTGGTTACCGAAGGGTCAGAGACCGCAAATTGACCAAACCCGAAATGGGTCATCTCCATAAGGTCGGCGCCATTCCCATGCGCCATCTTCAGGAGTTCCGTCTTCAAGCCATCGATGGCTTCGACCTTAATCAGCGCCTTCTTTTTGATGAAACTTTCAAGGAGGGTGATCTTGTTGATGTCTCTGGCACCACCATTGGCAAGGGTTTCCAAGGTGGAATCAAGCGTCATAACTTCAAAAGGGGTCCAATGACACATGGTTCCAAGAGTCACCGACAACTAGGATCAATTGGTGCTGGAACCACGCCTGGTCGTGTTTACAAGGGGAAGAAGATGCCTGGTAGGATGGGAGGAACCAAGAGGAAGATCAGAAAGCTTAAGATTGTCAAAATTGATAAAGATCTTAATGTCCTCATGATCAAAGGTGCTCTCCCTGGTAAGCCAGGCAATCTTCTAAGGATAACTCCTGCCAAGATTGTCGGCAAGAACATTCCAAAGAATTAG

Predicted protein sequences of Glyma06g00420

Limit To All Plant Sequences

>Glyma06g00420.1   sequence type=predicted peptide   gene model=Glyma06g00420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSILSVPSPTQRCSISISRLPLPLPLPFQLQVRRRAKGGKVVMSMEAGIGVMGTKLGMMSYFESDGEVVPVTVVGFKEGNIVTQIKTEATDGYDAVQVGYRRVRDRKLTKPEMGHLHKVGAIPMRHLQEFRLQAIDGFDLNQRLLFDETFKEGDLVDVSGTTIGKGFQGGIKRHNFKRGPMTHGSKSHRQLGSIGAGTTPGRVYKGKKMPGRMGGTKRKIRKLKIVKIDKDLNVLMIKGALPGKPGNLLRITPAKIVGKNIPKN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain