SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g00391

Feature Type:gene_model
Chromosome:Gm06
Start:154267
stop:155482
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g00391
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G08540AT Annotation by Michelle Graham. TAIR10: RNApolymerase sigma subunit 2 | chr1:2703461-2706696 FORWARD LENGTH=572 SoyBaseE_val: 2.00E-36ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006352GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006399GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA metabolic process SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0071482GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to light stimulus SoyBaseN/AISS
GO:2001141GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of RNA biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0003899GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity SoyBaseN/AISS
GO:0016987GO-mf Annotation by Michelle Graham. GO Molecular Function: sigma factor activity SoyBaseN/AISS
PF04545PFAM Sigma-70, region 4 JGI ISS
UniRef100_G7J988UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA polymerase sigma factor rpoD n=1 Tax=Medicago truncatula RepID=G7J988_MEDTR SoyBaseE_val: 4.00E-35ISS
UniRef100_I1K6W7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1K6W7_SOYBN SoyBaseE_val: 8.00E-46ISS

Expression Patterns of Glyma06g00391
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g00391 not represented in the dataset
Glyma06g00391 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g00391
ParalogEvidenceComments
Glyma04g00330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g00391 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g00391
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g00391
>Glyma06g00391.1   sequence type=CDS   gene model=Glyma06g00391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAGGACCTAGAAGAGGCTCTGGACAGTCTCAATGCAAGAGAGAGGCAGGTGGTAAGATGGAGATTTGGTATGGATGATGGAAGGACGAAGACCCTGCAAGAGATAGGGGAGATGTTGGGTGTGAGTAGGGAGAGAATTAGGCAAATCGAGTCAAGTGCTTTTAAGAAGCTTAAGAACAAGAAGAGAACCAATCATTTGCAGCAGTATTTGGTTTCATAA
Predicted protein sequences of Glyma06g00391
>Glyma06g00391.1   sequence type=predicted peptide   gene model=Glyma06g00391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKDLEEALDSLNARERQVVRWRFGMDDGRTKTLQEIGEMLGVSRERIRQIESSAFKKLKNKKRTNHLQQYLVS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo