SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g38380

Feature Type:gene_model
Chromosome:Gm05
Start:41753721
stop:41755649
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g38380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13180AT Annotation by Michelle Graham. TAIR10: NAC domain containing protein 83 | chr5:4196643-4197577 FORWARD LENGTH=252 SoyBaseE_val: 2.00E-68ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF02365PFAM No apical meristem (NAM) protein JGI ISS
UniRef100_G7LI31UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAC domain protein n=1 Tax=Medicago truncatula RepID=G7LI31_MEDTR SoyBaseE_val: 3.00E-111ISS
UniRef100_I1K6Q9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6Q9_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma05g38380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g38380
ParalogEvidenceComments
Glyma08g01280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g38380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g202300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g38380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g38380
>Glyma05g38380.1   sequence type=CDS   gene model=Glyma05g38380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAGCTGAATTTTGTTAAAAATGGAGTGAGCAAATTGCCTCCTGGTTTTCGTTTTCAGCCAACAGATGAAGAGCTTGTTTTTCAATACTTGAAATGTAAGGTCTTCTCCTACCCCTTGCCTGCTTCTATCATTCCTGAGATCAATGTCTGCAAGTATGATCCTTGGGATTTGCCAGGGAATTGTGATCCACAAGAGAGGCACTTTTTCAGCCCGAAGGAAGCAAAGTATCGAAATGGTAATCGCATGAACCGAACGACAAAGTGTGGCTATTGGAAGGCAACAGGATCAGACAAAAGAATATCATCTTCAACTTCAACGTGTAATGGTATTGTTGGGGTACGAAAGACATTGATATTTTATGAGGGCAAATCACCAAAAGGCTCCAGAACTCACTGGGTCTTGCACGAATATCGTCTCGTCAGTGTAGAAACTGGTGCTGCCAACTCATCCCATAACTACGTAAACGAGATAGGAGATTGGGTTCTGTGTCGCTTATCGATGAAGAAAAGAAGTGTAGAAAGTGATGGCAGCGGCACTCATCATAAGCATAGACAAAATACAGCAGTTCAAACTACTCGTCCAAGATTAATGTTTGATTTTATGATGGTAGGGAAGACCAATTCTTCTACATCCTCATCATGTTCAAGCTCCAGTAATATCATGGAGGTCTCTTCAAATGCATCGGACCATGAAGAAACAAGTGGCTATGCCCATTTTTAG
Predicted protein sequences of Glyma05g38380
>Glyma05g38380.1   sequence type=predicted peptide   gene model=Glyma05g38380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKLNFVKNGVSKLPPGFRFQPTDEELVFQYLKCKVFSYPLPASIIPEINVCKYDPWDLPGNCDPQERHFFSPKEAKYRNGNRMNRTTKCGYWKATGSDKRISSSTSTCNGIVGVRKTLIFYEGKSPKGSRTHWVLHEYRLVSVETGAANSSHNYVNEIGDWVLCRLSMKKRSVESDGSGTHHKHRQNTAVQTTRPRLMFDFMMVGKTNSSTSSSCSSSSNIMEVSSNASDHEETSGYAHF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo