SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g38130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g38130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g38130

Feature Type:gene_model
Chromosome:Gm05
Start:41535463
stop:41536369
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11650AT Annotation by Michelle Graham. TAIR10: osmotin 34 | chr4:7025127-7026113 REVERSE LENGTH=244 SoyBaseE_val: 5.00E-106ISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
PF00314PFAM Thaumatin family JGI ISS
UniRef100_I1K6M9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6M9_SOYBN SoyBaseE_val: 1.00E-160ISS
UniRef100_P25096UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein P21 n=1 Tax=Glycine max RepID=P21_SOYBN SoyBaseE_val: 9.00E-143ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g38130 not represented in the dataset

Glyma05g38130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g204600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g38130.1   sequence type=CDS   gene model=Glyma05g38130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCTCTCAGAAAAGCCGTGTTCTTTGTAATCGCTCAATGCTTCACCTTTTCCGCATATGCTGCAAGGTTTGAAATCACAAACCGATGCACATACACTGTCTGGGCTGCGTCTGTGCCTGTTGGCGGTGGCGTGCAATTAAACCCGGGCCAGTCATGGTCCGTGGACGTGCCTGCAGGAACGAAAGGGGCCCGCGTTTGGGCCCGAACCGGCTGCAACTTCGACGGTTCGGGCCGCGGTGGATGCCAGACCGGTGACTGCGGGGGTGTCCTCGACTGCAAAGCTTACGGTGCGCCTCCCAACACCCTGGCTGAATACGGCCTGAACGGGTTCAACAATTTGGACTTCTTCGACATCTCCCTCGTCGACGGTTTTAACGTGCCCATGGACTTTAGTCCAACCTCGAATGGATGCACACGTGGCATAAGCTGCACTGCGGACATTAACGGACAGTGCCCTAGTGAGCTAAAGACTCAAGGAGGTTGCAACAACCCTTGCACTGTCTTCAAAACCGACCAGTACTGTTGCAATTCCGGTAGCTGTGGGCCCACTGATTATTCCAGATTCTTCAAGCAAAGGTGCCCCGATGCTTATAGTTACCCCAAGGATGATCCAACTAGCACCTTCACTTGTAATGGTGGGACTGACTATAGGGTTGTCTTTTGTCCTTGA

>Glyma05g38130.1   sequence type=predicted peptide   gene model=Glyma05g38130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAALRKAVFFVIAQCFTFSAYAARFEITNRCTYTVWAASVPVGGGVQLNPGQSWSVDVPAGTKGARVWARTGCNFDGSGRGGCQTGDCGGVLDCKAYGAPPNTLAEYGLNGFNNLDFFDISLVDGFNVPMDFSPTSNGCTRGISCTADINGQCPSELKTQGGCNNPCTVFKTDQYCCNSGSCGPTDYSRFFKQRCPDAYSYPKDDPTSTFTCNGGTDYRVVFCP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo