SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g38090

Feature Type:gene_model
Chromosome:Gm05
Start:41513236
stop:41515185
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g38090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G63220AT Annotation by Michelle Graham. TAIR10: Calcium-dependent lipid-binding (CaLB domain) family protein | chr1:23449017-23450244 FORWARD LENGTH=147 SoyBaseE_val: 2.00E-59ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1030 KOG Predicted Ca2+-dependent phospholipid-binding protein JGI ISS
PTHR26357Panther FAMILY NOT NAMED JGI ISS
PTHR26357:SF5Panther JGI ISS
PF00168PFAM C2 domain JGI ISS
UniRef100_B6UGX7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Elicitor-responsive protein 3 n=1 Tax=Zea mays RepID=B6UGX7_MAIZE SoyBaseE_val: 1.00E-68ISS
UniRef100_I1K6M1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6M1_SOYBN SoyBaseE_val: 1.00E-104ISS

Expression Patterns of Glyma05g38090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g38090
ParalogEvidenceComments
Glyma08g01490 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g38090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g204900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g38090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g38090
>Glyma05g38090.1   sequence type=CDS   gene model=Glyma05g38090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCAGGGAAGCCTTGAAGTTTTTCTTGTTAATGCCAAAGGCCTCGACAACACTGATTATCTTTGTAACATGGACCCTTATGTGATCCTCATATGTCGCACTCAGGAGCAAAAGAGCAGTGTTGCAACAGGTCACGGAAGTGAGCCAGAATGGAACGAGAATTTTGTATTCAACGTGTCTGAAGGCGTTTCCGATCTGAGATTGAAGATCATGGACAGTGATTCCACGACGGCTCATGATCTCGTCGGAGAAGCTACCATTCCACTGGATGCATTGTATATTGAAGGAAGTATCCCTCCAACTTCATACAATGTTGTCAAGGATGGCCACTATTGTGGAGAGATTAAAATTGGCCTAACTTTTACGCCTCAGGATCGCAGCGAACGCTGCCTAGAGGAAAATTTTGGAGGATGGAAGGAGTCAGGCTACAGAGACTGA
Predicted protein sequences of Glyma05g38090
>Glyma05g38090.1   sequence type=predicted peptide   gene model=Glyma05g38090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPQGSLEVFLVNAKGLDNTDYLCNMDPYVILICRTQEQKSSVATGHGSEPEWNENFVFNVSEGVSDLRLKIMDSDSTTAHDLVGEATIPLDALYIEGSIPPTSYNVVKDGHYCGEIKIGLTFTPQDRSERCLEENFGGWKESGYRD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo