Glyma05g37891 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g37891): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g37891): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g37891

Feature Type:	gene_model
Chromosome:	Gm05
Start:	41390498
stop:	41391315
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g37891

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G11600	AT	Annotation by Michelle Graham. TAIR10: glutathione peroxidase 6 \| chr4:7010021-7011330 REVERSE LENGTH=232	SoyBase	E_val: 4.00E-12	ISS
GO:0006333	GO-bp	Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0007623	GO-bp	Annotation by Michelle Graham. GO Biological Process: circadian rhythm	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004602	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutathione peroxidase activity	SoyBase	N/A	ISS
PTHR11592	Panther	GLUTATHIONE PEROXIDASE	JGI		ISS
PF00255	PFAM	Glutathione peroxidase	JGI		ISS
UniRef100_I1KP95	UniRef	Annotation by Michelle Graham. Best UniRef hit: Glutathione peroxidase n=2 Tax=Glycine max RepID=I1KP95_SOYBN	SoyBase	E_val: 6.00E-15	ISS
UniRef100_I1KP95	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutathione peroxidase n=2 Tax=Glycine max RepID=I1KP95_SOYBN	SoyBase	E_val: 6.00E-15	ISS

Expression Patterns of Glyma05g37891

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g37891 not represented in the dataset	Glyma05g37891 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g37891 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g207200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g37891

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g37891

Limit To All Plant Sequences

>Glyma05g37891.1   sequence type=CDS   gene model=Glyma05g37891   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACACCCACGGAAACCGATTCTAAACTCACTTCTGACTCTAATCGGAGCTGTTGCCTTCTCTTCCTGTTCGCCCACCATGACCACCCAATCCACCAACCATCAAAAGTCCGTCTTTGATTTTACTGTCAAGGATGCTAAAGGCGATGATGTGGATCTTGCTACTTACAAGGGGAAAGTCCTGCTGATTGTTAATGTTGCTTCCAAATGGTATGCTCCTCTGCTATATATATGTATCCTTTTCAGAAATATCTTACACATACCAAATATATATTCGACATTTTCAGAAAATATCATTCTTAAAACTCATGATTCGCAGGGCCAGGATGGAAAAAAAAAAATTGTATATCAAACGCCTCCTTAG

Predicted protein sequences of Glyma05g37891

Limit To All Plant Sequences

>Glyma05g37891.1   sequence type=predicted peptide   gene model=Glyma05g37891   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAHPRKPILNSLLTLIGAVAFSSCSPTMTTQSTNHQKSVFDFTVKDAKGDDVDLATYKGKVLLIVNVASKWYAPLLYICILFRNILHIPNIYSTFSENIILKTHDSQGQDGKKKIVYQTPP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain