Report for Sequence Feature Glyma05g37730
Feature Type: gene_model
Chromosome: Gm05
Start: 41267119
stop: 41268867
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g37730
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G00430 AT
Annotation by Michelle Graham. TAIR10: plasma membrane intrinsic protein 1;4 | chr4:186143-187531 REVERSE LENGTH=287
SoyBase E_val: 0 ISS
GO:0006810 GO-bp
Annotation by Michelle Graham. GO Biological Process: transport
SoyBase N/A ISS
GO:0006826 GO-bp
Annotation by Michelle Graham. GO Biological Process: iron ion transport
SoyBase N/A ISS
GO:0006833 GO-bp
Annotation by Michelle Graham. GO Biological Process: water transport
SoyBase N/A ISS
GO:0009414 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to water deprivation
SoyBase N/A ISS
GO:0010106 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0016021 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane
SoyBase N/A ISS
GO:0005215 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transporter activity
SoyBase N/A ISS
GO:0015250 GO-mf
Annotation by Michelle Graham. GO Molecular Function: water channel activity
SoyBase N/A ISS
KOG0223
KOG
Aquaporin (major intrinsic protein family)
JGI ISS
PTHR19139 Panther
AQUAPORIN TRANSPORTER
JGI ISS
PTHR19139:SF55 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00230 PFAM
Major intrinsic protein
JGI ISS
UniRef100_C6TMV4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TMV4_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q06Z30 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin 1 n=1 Tax=Gossypium hirsutum RepID=Q06Z30_GOSHI
SoyBase E_val: 0 ISS
Expression Patterns of Glyma05g37730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma05g37730
Paralog Evidence Comments
Glyma08g01860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g37730 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g208700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g37730
Coding sequences of Glyma05g37730
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g37730.1 sequence type=CDS gene model=Glyma05g37730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGAGCAAAGAGGAAGATGTAAGGGTTGGAGCAACTAAGTTCTCAGAAAGGCAACCAATTGGTACAGCAGCTCAGGGTGACAAGGACTACAAAGAACCACCCCCAGCACCTTTGTTTGAGCCTGGTGAGCTAAAGTCATGGTCCTTCTACAGAGCTGGAATTGCTGAGTTTGTGGCCACTTTCTTGTTCCTCTACATTACCATCTTAACTGTCATGGGTGTCAACAGGTCACCCTCCAAGTGTGCCTCTGTTGGCATTCAAGGCATTGCTTGGGCCTTTGGTGGCATGATCTTTGCCCTTGTCTACTGCACTGCTGGAATTTCAGGGGGACACATCAACCCAGCTGTGACCTTTGGTCTCTTTTTGGCAAGGAAGCTGTCCCTCACAAGGGCGCTGTTCTACATTATCATGCAGTGTCTTGGAGCCATCTGTGGGGCTGGTGTGGTGAAGGGATTTGAGGGCAATGCTAGGTATGAGATGTTCAAAGGTGGAGCCAATTTTGTGAATTCTGGATACACCAAGGGTGATGGACTTGGAGCTGAGATTGTTGGCACTTTTGTTCTTGTCTACACCGTTTTCTCTGCCACTGATGCCAAGAGAAACGCTAGAGACTCACACGTTCCTATTTTGGCTCCACTTCCCATCGGATTTGCTGTGTTCTTGGTCCACTTGGCTACCATTCCCATCACAGGAACTGGCATTAACCCAGCTAGGAGTCTCGGAGCTGCCATCATCTACAACAGAGACCATGCATGGGATGACCAATGGATTTTCTGGGTTGGACCTTTCATTGGAGCTGCCCTTGCTGCTGTGTATCACCAGATAGTCATCCGAGCCATCCCTTTCAAGACAAGGGCTTAG
Predicted protein sequences of Glyma05g37730
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g37730.1 sequence type=predicted peptide gene model=Glyma05g37730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MESKEEDVRVGATKFSERQPIGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYIIMQCLGAICGAGVVKGFEGNARYEMFKGGANFVNSGYTKGDGLGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDHAWDDQWIFWVGPFIGAALAAVYHQIVIRAIPFKTRA*