Glyma05g37370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g37370

Feature Type:	gene_model
Chromosome:	Gm05
Start:	40977880
stop:	40982233
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g37370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G11240	AT	Annotation by Michelle Graham. TAIR10: Calcineurin-like metallo-phosphoesterase superfamily protein \| chr4:6847333-6849032 FORWARD LENGTH=322	SoyBase	E_val: 0	ISS
GO:0006470	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation	SoyBase	N/A	ISS
GO:0051604	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein maturation	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0004722	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
KOG0374	KOG	Serine/threonine specific protein phosphatase PP1, catalytic subunit	JGI		ISS
PTHR11668	Panther	SERINE/THREONINE PROTEIN PHOSPHATASE	JGI		ISS
PTHR11668:SF136	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00149	PFAM	Calcineurin-like phosphoesterase	JGI		ISS
UniRef100_I1K6D8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Serine/threonine-protein phosphatase n=1 Tax=Glycine max RepID=I1K6D8_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1K6D8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine-protein phosphatase n=1 Tax=Glycine max RepID=I1K6D8_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma05g37370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g37370

Paralog	Evidence	Comments
Glyma08g02180	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g37370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g212100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g37370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g37370

Limit To All Plant Sequences

>Glyma05g37370.1   sequence type=CDS   gene model=Glyma05g37370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGAGAACCTGCTCGACGATATTATCCGGAGGCTCGTCGCGGCGAAGAACGGTAGAACGACGAAGCAGGTGCAGCTTACGGAGGCAGAAATTCGACAACTCTGTGTTTCCTCCAAAGAGATCTTTCTCAGTCAACCTAATCTTCTCGAACTCGAGGCTCCTATTAAGATTTGTGGAGATGTTCATGGCCAATACTCAGATCTTTTAAGGTTGTTCGAATATGGGGGATACCCACCTGAAGCAAATTATTTATTTCTCGGAGATTATGTTGATCGTGGTAAGCAGAGCATAGAGACAATATGTTTACTCCTCGCCTACAAGATCAAATACAAGGAGAATTTCTTTCTTCTCAGGGGCAACCATGAGTGTGCATCCATCAATCGTATATATGGTTTCTATGATGAGTGTAAGAGGAGGTTTAATGTTCGCCTCTGGAAGACATTTACTGATTGCTTTAATTGCCTTCCTGTCGCTGCTCTGATAGATGAGAAGATCCTTTGCATGCATGGTGGACTATCGCCTGATCTTAAACACTTGGATCAGATTCGAAGTATTGCTCGTCCTATTGATGTGCCAGATCATGGCCTTCTATGTGACCTTCTATGGGCTGATCCTGATAAAGATCTTGATGGGTGGGGAGAAAATGACCGAGGTGTATCATTTACATTTGGGGCTGACACCGTTGTTGAATTTCTTGAACATCATGATCTCGATCTGATTTGCAGAGCTCACCAGGTTGTAGAGGATGGATATGAGTTTTTTGCCAAGCGTCAGCTGGTGACGATATTCTCCGCACCAAATTACTGCGGTGAATTTGATAATGCTGGTGCTATGATGAGTGTGGATGACACCTTGACATGCTCTTTCCAAATACTTAAATCTTCTGAAAAGAAAGGGAAAGGTGGATTTGGCATCAACACATCAAGACCAGGAACTCCACCCCATAAGGGTGGGAAGAATTAA

Predicted protein sequences of Glyma05g37370

Limit To All Plant Sequences

>Glyma05g37370.1   sequence type=predicted peptide   gene model=Glyma05g37370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDENLLDDIIRRLVAAKNGRTTKQVQLTEAEIRQLCVSSKEIFLSQPNLLELEAPIKICGDVHGQYSDLLRLFEYGGYPPEANYLFLGDYVDRGKQSIETICLLLAYKIKYKENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKTFTDCFNCLPVAALIDEKILCMHGGLSPDLKHLDQIRSIARPIDVPDHGLLCDLLWADPDKDLDGWGENDRGVSFTFGADTVVEFLEHHDLDLICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSVDDTLTCSFQILKSSEKKGKGGFGINTSRPGTPPHKGGKN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain