|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G25060 | AT | Annotation by Michelle Graham. TAIR10: early nodulin-like protein 14 | chr2:10662308-10662930 FORWARD LENGTH=182 | SoyBase | E_val: 8.00E-19 | ISS |
| GO:0000226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
| GO:0016572 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone phosphorylation | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0031225 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane | SoyBase | N/A | ISS |
| GO:0046658 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane | SoyBase | N/A | ISS |
| GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| PF02298 | PFAM | Plastocyanin-like domain | JGI | ISS | |
| UniRef100_F4YAW4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Copper binding protein 5 n=1 Tax=Gossypium hirsutum RepID=F4YAW4_GOSHI | SoyBase | E_val: 2.00E-24 | ISS |
| UniRef100_I1K6B4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K6B4_SOYBN | SoyBase | E_val: 8.00E-87 | ISS |
|
Glyma05g37110 not represented in the dataset |
Glyma05g37110 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g214500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g37110.1 sequence type=CDS gene model=Glyma05g37110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCGTGAAAATGCATCTTAGTTTCTTCATCTTAGCCACCATTGGCTGCATGCCATTGGTATCTGTGAGTTCGACGACTCATGTTGTCGGACACAAATTGGGTTGGAATTTGCCCAGTTACCCAGGGTTCTACGACGACTGGGCCAAGAAACAAACCTTCGTTGTTGGTGACGTGCTTCTTTTCCAGTATCACCCAGGACAGAACACGGTGGTTCAGGTAGACAAGAACGACTACGATCATTGCACTACCAGAAATATCCTCCACACCTACTTCAGAGGGAACTCTTCTGCTACTTTGGAGAAGCCTGGGGACTATTTTTACTTCTCTTCCGTTGGCAAGCATTGCGACTTTGGCCAAAAGCTTCATGTTACTGTTTCTCAGTGA
>Glyma05g37110.1 sequence type=predicted peptide gene model=Glyma05g37110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAVKMHLSFFILATIGCMPLVSVSSTTHVVGHKLGWNLPSYPGFYDDWAKKQTFVVGDVLLFQYHPGQNTVVQVDKNDYDHCTTRNILHTYFRGNSSATLEKPGDYFYFSSVGKHCDFGQKLHVTVSQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||