SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g36800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g36800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g36800

Feature Type:gene_model
Chromosome:Gm05
Start:40564215
stop:40568685
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G24270AT Annotation by Michelle Graham. TAIR10: Calcium-binding EF-hand family protein | chr5:8238781-8240179 REVERSE LENGTH=222 SoyBaseE_val: 2.00E-84ISS
GO:0005513GO-bp Annotation by Michelle Graham. GO Biological Process: detection of calcium ion SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0010118GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal movement SoyBaseN/AISS
GO:0019722GO-bp Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling SoyBaseN/AISS
GO:0030007GO-bp Annotation by Michelle Graham. GO Biological Process: cellular potassium ion homeostasis SoyBaseN/AISS
GO:0042539GO-bp Annotation by Michelle Graham. GO Biological Process: hypotonic salinity response SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005955GO-cc Annotation by Michelle Graham. GO Cellular Compartment: calcineurin complex SoyBaseN/AISS
GO:0004723GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-dependent protein serine/threonine phosphatase activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0034 KOG Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein JGI ISS
PTHR23056Panther CALCINEURIN B JGI ISS
PTHR23056:SF17Panther JGI ISS
UniRef100_B9RCU5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calcineurin B, putative n=1 Tax=Ricinus communis RepID=B9RCU5_RICCO SoyBaseE_val: 1.00E-98ISS
UniRef100_I1KPK9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KPK9_SOYBN SoyBaseE_val: 7.00E-144ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g36800 not represented in the dataset

Glyma05g36800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g02740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g217700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g36800.2   sequence type=CDS   gene model=Glyma05g36800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTGTTGTTGCACCAAACAGCGAGTCGATCATAAAGATCCAGCAGTTCTTGCTTCCCAAACCTATTTTAATATTTCTGAAATTGAAGCACTGTATGATCTGTTCAAGAAATTAAGCAGCTCCATCATCCACGACGGGGTTATCAGCAAAGAAGAGTTTCAGCTTGGCTTATTTGGAAGCAGCGAGAAACGGAGCCTCTTTGCCGACAGGGTCTTCCAATTATTTGACTCAAAAAATGATGGGGTGATAGAATTTGGAGAGTTCGTTAAAGCTCTCAGCGTCTTCCACCCAGCAGCGCCACAAGCACAAAAAGCAGATTTTGCATTTCGACTCTATGATATAAGTCAAAGAGGCTTTATTGAACGTGGCGAGGTAAGAGAGATGATCCTGGCACTACTGAATGAGTCAGATTTGGTTCTGTGTCATGACATTATTGAGGTCATAATTGACAAGACCTTTGAAGAATCAGACTCAAAAGGAGATGGAAGGATTGATCCAGAGGAGTGGCAAGAATTTGTAGCTCGAAATCCATCCTTATTGTTGAGGAACATGACAATTCCCTATTTGAAGGATCTTACTACACAGTTTCCTAGTTTCAAGCTAACATCAGGCATTGAAGACTGTACGAGCAGCTCATCCACTGAGAAAGATATCATCTTAGAAGGACAAGTTCAACGGTGTCAGCATTAA

>Glyma05g36800.2   sequence type=predicted peptide   gene model=Glyma05g36800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGCCCTKQRVDHKDPAVLASQTYFNISEIEALYDLFKKLSSSIIHDGVISKEEFQLGLFGSSEKRSLFADRVFQLFDSKNDGVIEFGEFVKALSVFHPAAPQAQKADFAFRLYDISQRGFIERGEVREMILALLNESDLVLCHDIIEVIIDKTFEESDSKGDGRIDPEEWQEFVARNPSLLLRNMTIPYLKDLTTQFPSFKLTSGIEDCTSSSSTEKDIILEGQVQRCQH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo