SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g36420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g36420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g36420

Feature Type:gene_model
Chromosome:Gm05
Start:40244336
stop:40245583
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G41685AT Annotation by Michelle Graham. TAIR10: Mitochondrial outer membrane translocase complex, subunit Tom7 | chr5:16669419-16669646 REVERSE LENGTH=75 SoyBaseE_val: 7.00E-24ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0005741GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
KOG4449 KOG Translocase of outer mitochondrial membrane complex, subunit TOM7 JGI ISS
PF08038PFAM TOM7 family JGI ISS
UniRef100_B9SC98UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import receptor subunit TOM7-1, putative n=1 Tax=Ricinus communis RepID=B9SC98_RICCO SoyBaseE_val: 2.00E-32ISS
UniRef100_I1K650UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K650_SOYBN SoyBaseE_val: 3.00E-44ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g36420 not represented in the dataset

Glyma05g36420 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g03150 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g221400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g36420.1   sequence type=CDS   gene model=Glyma05g36420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTCAAGGGTTTCTCTGAAGGCGAAGGGTAAGAGTTCAAAGGGATCGAAGGCCGCGGAAGATCGATCTGCGAGCGAGTGCCTGAAGGAGTGGACGACATGGGCAATGCGAAAAGCGAAGGTCATCACTCACTATGGTTTCATCCCTTTGGTCATCATCATCGGTATGAACTCTGACCCCAAGCCCCCACTTTCCCAGCTTCTCAGCCCCGTCTGA

>Glyma05g36420.1   sequence type=predicted peptide   gene model=Glyma05g36420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASRVSLKAKGKSSKGSKAAEDRSASECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo