SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g36200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g36200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g36200

Feature Type:gene_model
Chromosome:Gm05
Start:40062263
stop:40064523
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g36200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G29430AT Annotation by Michelle Graham. TAIR10: ribosomal protein S15A E | chr4:14472440-14473383 FORWARD LENGTH=129 SoyBaseE_val: 4.00E-76ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1754 KOG 40S ribosomal protein S15/S22 JGI ISS
PTHR11758Panther 30S RIBOSOMAL PROTEIN S8 JGI ISS
PF00410PFAM Ribosomal protein S8 JGI ISS
UniRef100_B7FH41UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S15a-5 n=1 Tax=Medicago truncatula RepID=B7FH41_MEDTR SoyBaseE_val: 1.00E-80ISS
UniRef100_I1K628UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K628_SOYBN SoyBaseE_val: 2.00E-90ISS

Expression Patterns of Glyma05g36200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g36200 not represented in the dataset
Glyma05g36200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g36200
ParalogEvidenceComments
Glyma08g03450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g36200 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g223500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g36200
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g36200
>Glyma05g36200.1   sequence type=CDS   gene model=Glyma05g36200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAGGAGGATACTGAATGATGCGTTGAGGAGTATGGTGAATGCAGAGAGGAGAGGGAAAGCTTTGGTGGAACTCAAGCCAATCTCCACTGTTATGTCTTCCTTTCTCCAAATCATGAAACACCATGGGTATATCAAGGACTTTCAAGTCTATGATCCGCATAGAGTGGGGAGGATAAGAGTTGAACTACAAGGTAGGATTAACGATTGCAAGGCCCTTTCGCACCGAAAGGACCTTAAGGCAAGGGATATTGAAGCCTATAGATTGCAGACTCTTCCAACACATCAGTGGGGTTATGTTGTCATTACAACTCCTGATGGTATTTTGGATCATGAAGAGGCCATTAGGAAGAATGTAGGTGGCCAGGTTCTTGGTTACTTTCACTAA
Predicted protein sequences of Glyma05g36200
>Glyma05g36200.1   sequence type=predicted peptide   gene model=Glyma05g36200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRRILNDALRSMVNAERRGKALVELKPISTVMSSFLQIMKHHGYIKDFQVYDPHRVGRIRVELQGRINDCKALSHRKDLKARDIEAYRLQTLPTHQWGYVVITTPDGILDHEEAIRKNVGGQVLGYFH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo