SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g35990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g35990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g35990

Feature Type:gene_model
Chromosome:Gm05
Start:39913488
stop:39917453
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G29330AT Annotation by Michelle Graham. TAIR10: DERLIN-1 | chr4:14444937-14446952 FORWARD LENGTH=266 SoyBaseE_val: 3.00E-120ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG0858 KOG Predicted membrane protein JGI ISS
PTHR11009Panther DER1-LIKE PROTEIN, DERLIN JGI ISS
PF04511PFAM Der1-like family JGI ISS
UniRef100_G7L7D6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Derlin-1 n=1 Tax=Medicago truncatula RepID=G7L7D6_MEDTR SoyBaseE_val: 2.00E-147ISS
UniRef100_I1K603UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K603_SOYBN SoyBaseE_val: 7.00E-176ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g35990 not represented in the dataset

Glyma05g35990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g03630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g225500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g35990.1   sequence type=CDS   gene model=Glyma05g35990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTCTCCCGCTGAGTTTTATCACTCTCTTCCGCCAATAACGAAGGCATATGGCACCGTTTGCCTGTTGGCTACCGCAACTTACCATCTTGGATTAGATCATCCAGCTTACATTGCACTATTGTACGATAAAGTGTTCTACGGTTTTCAGGCTTGGAGGTTGTTCACTAACTTATTTTTCCTTGGACCGTTCTCTATCAATTTTGGGATCCGTCTCCTAATGATAGTAAGGTATGGTGTCCAACTTGAGAAAGGACCATTTGACCGACGGACTGCTGATTTCTTGTGGATGATGATATTTGGTGCCTTTGCACTATTGGTTTTATCTGCTATACCCATATTTTGGTCCCCATTTTTGGCAGTACCACTTGTTTTTATGCTCCTTTATGTTTGGAGTAGAGAATTTCCGAATGCCCAAATCAACATATATGGGCTTGTTGCACTTAAGGCCTTCTATCTTCCATGGGCGATGCTGGCTTTGGACATCATTTTTGGATCGCCTCTTATACCTGACCTCTTAGGTATCATTGCAGGACATCTGTACTACTTCTTGACAGTGTTGCATCCACTAGCAGGTGGAAAGAACATTTTGAAGACTCCAATGTGGGTACATAAATTGGTAGCAAGATGGATAATTGGAGTGCAACCAATTAGCCGTGGGCAGGCTGCTAATGACCCTCAGCAAGAGAGGGGCTCGGGAGTTGCTTTCAGGGGAAGATCCTATCGACTTGGTGGATAG

>Glyma05g35990.1   sequence type=predicted peptide   gene model=Glyma05g35990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSPAEFYHSLPPITKAYGTVCLLATATYHLGLDHPAYIALLYDKVFYGFQAWRLFTNLFFLGPFSINFGIRLLMIVRYGVQLEKGPFDRRTADFLWMMIFGAFALLVLSAIPIFWSPFLAVPLVFMLLYVWSREFPNAQINIYGLVALKAFYLPWAMLALDIIFGSPLIPDLLGIIAGHLYYFLTVLHPLAGGKNILKTPMWVHKLVARWIIGVQPISRGQAANDPQQERGSGVAFRGRSYRLGG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo