Glyma05g35640 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g35640

Feature Type:	gene_model
Chromosome:	Gm05
Start:	39645297
stop:	39648491
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g35640

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G29080	AT	Annotation by Michelle Graham. TAIR10: phytochrome-associated protein 2 \| chr4:14323665-14325213 REVERSE LENGTH=305	SoyBase	E_val: 3.00E-99	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006417	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of translation	SoyBase	N/A	ISS
GO:0007389	GO-bp	Annotation by Michelle Graham. GO Biological Process: pattern specification process	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0048438	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral whorl development	SoyBase	N/A	ISS
GO:0048439	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower morphogenesis	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
PF02309	PFAM	AUX/IAA family	JGI		ISS
UniRef100_C6TKK4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TKK4_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_G7L869	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Auxin-responsive protein (Aux/IAA) n=1 Tax=Medicago truncatula RepID=G7L869_MEDTR	SoyBase	E_val: 1.00E-138	ISS

Expression Patterns of Glyma05g35640

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g35640

Paralog	Evidence	Comments
Glyma08g04070	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g35640 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g229300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g35640

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g35640

Limit To All Plant Sequences

>Glyma05g35640.1   sequence type=CDS   gene model=Glyma05g35640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGAGGCATTGGAAGATGTTCCTTCAATGAAAGGAGGGTGTGAAGAAGAAGAAGAAGGGTTGAACCTGAAGGCTACTGAGCTGAGGCTTGGGTTACCAGGGTGTGAGTCACCAGAGAGGGAGGGTGCGTTTAGGAGTGTGGTGGTGTCTGGGGCCAAGAGGGGTTTCTCTGATGCCATTGATGAAAACTGGAATGGTGGATCTGAAAAAGATGCTGCCTTGTTTTCTCCAAGGGGTGCTGTTAGTGTTAGTGCTGCCAAGTCTCTCACTCTCACTGCAACAGACTGCACCAACCAACCAACTGCTTTGGGTGCTTCTGTTCTCAAGGAAACTGTTCCACGCTCTCCAAAACCATTGCATGAGAAAAAGCCCCAGATTTCTGCTCCAGCTGCTAAGGCGCAGGTTGTGGGATGGCCACCAATCCGTTCATTCAGGAAGAACTCAATGGCTTCTCAGCCTCAAAAGAATGATACTGATGCAGAAGCCAAGTCTGGATGCCTTTATGTTAAAGTCAGCATGGAAGGCGCCCCATACTTGAGGAAAGTGGATCTGAATAGTTTTACCACTTACAAGGACCTCTCTTTGGCACTTGAAAAGATGTTTAGTTGTTTTACACTCAGTCAATGTGGCTCTTATGGGGTTTCTAGTCGAGAAAATTTAAGTGAAAGTAGATTGATGGATCTCCTTCATGGTTCAGAATATGTTCTTACCTATGAAGACAAGGACGGAGATTGGATGCTAGTTGGTGATGTTCCGTGGGAGATGTTCACTGAGTCTTGCAAGAGGCTGAGGATAATGAAGAGTTTTGAAGCAATTGGGCTAGCACCTAGAGCCATGGAAAAGTGCAAAAGTCGTAACTAG

Predicted protein sequences of Glyma05g35640

Limit To All Plant Sequences

>Glyma05g35640.1   sequence type=predicted peptide   gene model=Glyma05g35640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSEALEDVPSMKGGCEEEEEGLNLKATELRLGLPGCESPEREGAFRSVVVSGAKRGFSDAIDENWNGGSEKDAALFSPRGAVSVSAAKSLTLTATDCTNQPTALGASVLKETVPRSPKPLHEKKPQISAPAAKAQVVGWPPIRSFRKNSMASQPQKNDTDAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRENLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSFEAIGLAPRAMEKCKSRN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain