SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g35231): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g35231): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g35231

Feature Type:gene_model
Chromosome:Gm05
Start:39313735
stop:39317869
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18450AT Annotation by Michelle Graham. TAIR10: actin-related protein 4 | chr1:6348199-6351766 FORWARD LENGTH=441 SoyBaseE_val: 1.00E-66ISS
GO:0000003GO-bp Annotation by Michelle Graham. GO Biological Process: reproduction SoyBaseN/AISS
GO:0000398GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006312GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic recombination SoyBaseN/AISS
GO:0006325GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin organization SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0006346GO-bp Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0010638GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization SoyBaseN/AISS
GO:0016246GO-bp Annotation by Michelle Graham. GO Biological Process: RNA interference SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0031048GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0048235GO-bp Annotation by Michelle Graham. GO Biological Process: pollen sperm cell differentiation SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0048574GO-bp Annotation by Michelle Graham. GO Biological Process: long-day photoperiodism, flowering SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005200GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton SoyBaseN/AISS
PTHR11937Panther ACTIN JGI ISS
PTHR11937:SF32Panther ACTIN-RELATED M1 JGI ISS
PF00022PFAM Actin JGI ISS
UniRef100_B9RE21UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RE21_RICCO SoyBaseE_val: 3.00E-73ISS
UniRef100_UPI00023393C9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023393C9 related cluster n=1 Tax=unknown RepID=UPI00023393C9 SoyBaseE_val: 1.00E-107ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g35231 not represented in the dataset

Glyma05g35231 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g04490 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g35231.2   sequence type=transcript   gene model=Glyma05g35231   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATCTGAAGGGCCCAACAGAAATCCCAAAACGCGGCATCAACGGGAAACTCGAAACGAAAAAGCCCTTTTTCACCCCTTCCCAACGCACGTTTCGTTCTCTTCTCTCTGCTCTGCTCGTTGGATTTCAAACTCACATTCTCTCCCCTAGTCATGTATGGCGATGGTGAGTGTTCACTGTGGCCTCTCTTTTCTAACAAAATTGCAATTTTATTTTGTTGGTAATTGGCAGACAAAGCATCAGCAATAGTGATAGACCTGGGTTCGCACACTTGCAAAACCGGTTACACTGGCTAAGATGCTCCCAAGGCCGTCTTTCGCTCTGTTGTTGGTGCAATTGATCAAATGGACATTGATGGAACTGCTGATGTTGATGAGAACTCAGGAGCGGACAAAAACAAGGGAAAATGCAAACTTAACGTAGGGTCTCAGTCACTAGGATACCGCAGAGACTATATGGAGGTGCTGTCACCATTGAAGAATGGAGTTGTTGTTGACTGGAATATTGTAGACAACATATGGGATCATGCTTTGAGGGAATGCCTCCTAGTTGATCCTAAAGAGCGTCCAATGCTACTTGCCGAACCATGTTCCAACACTCAAGAACAGAGAGAATTCTGTCAACAGGCAGCAGAACTTATGTATGAAAAATATAAAGTACCAGCGTTGTTTTTGGCGAAGAATGCTGTTCTCACATCTTTTGCATCAGGGCGTGCTACCTCATTAGTTATTGATAGTGGTGGTGGATCAACTACTGATGTACCAGTACTGGATGGTTATGTTCTTCAAAAGAGAGAGCATATTCTAACATTCCTATGACTCCATGCGAGCTTCCTGATGGCCATGTTTGGATAGGGGGGAGTATACTGGCTTCTCTTGGCTCCTTCCAGTAGATGTGGTTCTCCAAGTCCGAGTATGAAGAGCAAGGTGCTTCTTATATCCAAAGAAAGTGCCCTTGAGTTTTCTAACGGATGTGAATACGTGTTTATTTTCTTACCATTATTGGGAGCCCGGCAGTTTCAGGAAGTCCAATGTTGAGCACTAAATTAGTGCCCTTGTCATCAATGACCTGTTTCGAATTCATGCTATTCTCTTCAGTGTTTTACTAGGCGGTTATAACTATTGTCTAGATTGATATTGACAGCTTATTTATCTGCTGTCGAGGTTGATGTAACATTATAACTATTCTGTAACTGGCACAAGCTCATTTTCTTTTTCTGCATCACACTGCATGACTGCATCCCCCTCCCATATAGTGTAATGACGTCTAAGTTAAATTCCTGTTGAAGTCTGGATAGTGGATAGCTAGCTATTACCGTTGCTGCACCCCATTGTGCTTATTGATGCCAATACAGTTAATGCTCGAGGCATTAGTGACACTTTAACTAAGCTAAATGACGTTGTACCTTAATTTGGTTGAGGCAAATGTATATGTTACAAGTTACAGCGTGAAAAGGCGTAGATTAATGATTCGATTTGTGTTGTACTAAATTAAAACATTTCAGAAAAAGAATAAAAAAATT

>Glyma05g35231.1   sequence type=CDS   gene model=Glyma05g35231   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATGGCGATGACAAAGCATCAGCAATAGTTGTTGGTGCAATTGATCAAATGGACATTGATGGAACTGCTGATGTTGATGAGAACTCAGGAGCGGACAAAAACAAGGGAAAATGCAAACTTAACGTAGGGTCTCAGTCACTAGGATACCGCAGAGACTATATGGAGGTGCTGTCACCATTGAAGAATGGAGTTGTTGTTGACTGGAATATTGTAGACAACATATGGGATCATGCTTTGAGGGAATGCCTCCTAGTTGATCCTAAAGAGCGTCCAATGCTACTTGCCGAACCATGTTCCAACACTCAAGAACAGAGAGAATTCTGTCAACAGGCAGCAGAACTTATGTATGAAAAATATAAAGTACCAGCGTTGTTTTTGGCGAAGAATGCTGTTCTCACATCTTTTGCATCAGGGCGTGCTACCTCATTAGTTATTGATAGTGGTGGTGGATCAACTACTGATGTACCAGTACTGGATGGTTATGTTCTTCAAAAGGTATTGCTTGCTGTCCTTGTTTGGATAGGGGGGAGTATACTGGCTTCTCTTGGCTCCTTCCAGTATGAAGAGCAAGGTGCTTCTTATATCCAAAGAAAGTGCCCTTGA

>Glyma05g35231.2   sequence type=CDS   gene model=Glyma05g35231   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACATTGATGGAACTGCTGATGTTGATGAGAACTCAGGAGCGGACAAAAACAAGGGAAAATGCAAACTTAACGTAGGGTCTCAGTCACTAGGATACCGCAGAGACTATATGGAGGTGCTGTCACCATTGAAGAATGGAGTTGTTGTTGACTGGAATATTGTAGACAACATATGGGATCATGCTTTGAGGGAATGCCTCCTAGTTGATCCTAAAGAGCGTCCAATGCTACTTGCCGAACCATGTTCCAACACTCAAGAACAGAGAGAATTCTGTCAACAGGCAGCAGAACTTATGTATGAAAAATATAAAGTACCAGCGTTGTTTTTGGCGAAGAATGCTGTTCTCACATCTTTTGCATCAGGGCGTGCTACCTCATTAGTTATTGATAGTGGTGGTGGATCAACTACTGATGTACCAGTACTGGATGGTTATGTTCTTCAAAAGAGAGAGCATATTCTAACATTCCTATGA

>Glyma05g35231.1   sequence type=predicted peptide   gene model=Glyma05g35231   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYGDDKASAIVVGAIDQMDIDGTADVDENSGADKNKGKCKLNVGSQSLGYRRDYMEVLSPLKNGVVVDWNIVDNIWDHALRECLLVDPKERPMLLAEPCSNTQEQREFCQQAAELMYEKYKVPALFLAKNAVLTSFASGRATSLVIDSGGGSTTDVPVLDGYVLQKVLLAVLVWIGGSILASLGSFQYEEQGASYIQRKCP*

>Glyma05g35231.2   sequence type=predicted peptide   gene model=Glyma05g35231   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDIDGTADVDENSGADKNKGKCKLNVGSQSLGYRRDYMEVLSPLKNGVVVDWNIVDNIWDHALRECLLVDPKERPMLLAEPCSNTQEQREFCQQAAELMYEKYKVPALFLAKNAVLTSFASGRATSLVIDSGGGSTTDVPVLDGYVLQKREHILTFL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo