Glyma05g35030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g35030

Feature Type:	gene_model
Chromosome:	Gm05
Start:	39175192
stop:	39176840
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g35030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G09500	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein S19 family protein \| chr5:2954044-2954850 REVERSE LENGTH=150	SoyBase	E_val: 5.00E-91	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0015935	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG0898	KOG	40S ribosomal protein S15	JGI		ISS
PTHR11880	Panther	40S RIBOSOMAL PROTEIN S15	JGI		ISS
PF00203	PFAM	Ribosomal protein S19	JGI		ISS
UniRef100_C6SWG3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWG3_SOYBN	SoyBase	E_val: 7.00E-108	ISS
UniRef100_I3NML4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S15D n=2 Tax=rosids RepID=I3NML4_HEVBR	SoyBase	E_val: 2.00E-99	ISS

Expression Patterns of Glyma05g35030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g35030

Paralog	Evidence	Comments
Glyma08g04690	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g35030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g234800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g35030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g35030

Limit To All Plant Sequences

>Glyma05g35030.1   sequence type=CDS   gene model=Glyma05g35030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGACGTTGAGGTCGATGTGGCGGCTGCAGCAGCAGCAGGGCAGCCGAAGAAGAGAACGTTCAAGAAGTTCAGTTTCAGGGGCGTGGATCTCGATGCGCTTCTGGACATGTCCACCGATGAACTCGTGAAGATGTTCAGTGCTCGCGCACGTAGAAGGTTCCAGAGAGGCCTCACCAGAAAGCCCATGGCCTTGATCAAGAAGCTTCGCAAAGCGAAAAGAGAAGCTCCACCAGGTGAGAAGCCAGAACCTGTCCGCACCCACCTCCGCAACATGATTATTGTGCCTGAGATGATTGGTAGCATTATTGGAGTGTACAATGGCAAGACCTTTAATCAGGTTGAAATCAAACCTGAGATGATTGGGCATTATCTGGCAGAGTTTTCTATTTCATACAAACCCGTTAAGCACGGGAGACCTGGTATTGGTGCTACTCACTCATCCAGGTTTATTCCTCTTAAGTGA

Predicted protein sequences of Glyma05g35030

Limit To All Plant Sequences

>Glyma05g35030.1   sequence type=predicted peptide   gene model=Glyma05g35030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADVEVDVAAAAAAGQPKKRTFKKFSFRGVDLDALLDMSTDELVKMFSARARRRFQRGLTRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain