SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma05g35030

Feature Type:gene_model
Chromosome:Gm05
Start:39175192
stop:39176840
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09500AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S19 family protein | chr5:2954044-2954850 REVERSE LENGTH=150 SoyBaseE_val: 5.00E-91ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0898 KOG 40S ribosomal protein S15 JGI ISS
PTHR11880Panther 40S RIBOSOMAL PROTEIN S15 JGI ISS
PF00203PFAM Ribosomal protein S19 JGI ISS
UniRef100_C6SWG3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWG3_SOYBN SoyBaseE_val: 7.00E-108ISS
UniRef100_I3NML4UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S15D n=2 Tax=rosids RepID=I3NML4_HEVBR SoyBaseE_val: 2.00E-99ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g04690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g234800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g35030.1   sequence type=CDS   gene model=Glyma05g35030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGACGTTGAGGTCGATGTGGCGGCTGCAGCAGCAGCAGGGCAGCCGAAGAAGAGAACGTTCAAGAAGTTCAGTTTCAGGGGCGTGGATCTCGATGCGCTTCTGGACATGTCCACCGATGAACTCGTGAAGATGTTCAGTGCTCGCGCACGTAGAAGGTTCCAGAGAGGCCTCACCAGAAAGCCCATGGCCTTGATCAAGAAGCTTCGCAAAGCGAAAAGAGAAGCTCCACCAGGTGAGAAGCCAGAACCTGTCCGCACCCACCTCCGCAACATGATTATTGTGCCTGAGATGATTGGTAGCATTATTGGAGTGTACAATGGCAAGACCTTTAATCAGGTTGAAATCAAACCTGAGATGATTGGGCATTATCTGGCAGAGTTTTCTATTTCATACAAACCCGTTAAGCACGGGAGACCTGGTATTGGTGCTACTCACTCATCCAGGTTTATTCCTCTTAAGTGA

>Glyma05g35030.1   sequence type=predicted peptide   gene model=Glyma05g35030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADVEVDVAAAAAAGQPKKRTFKKFSFRGVDLDALLDMSTDELVKMFSARARRRFQRGLTRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo