SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g34910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g34910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g34910

Feature Type:gene_model
Chromosome:Gm05
Start:39100836
stop:39103064
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g34910
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G23220AT Annotation by Michelle Graham. TAIR10: Dynein light chain type 1 family protein | chr1:8242614-8244136 FORWARD LENGTH=129 SoyBaseE_val: 8.00E-65ISS
GO:0007017GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005875GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule associated complex SoyBaseN/AISS
GO:0003777GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule motor activity SoyBaseN/AISS
KOG3430 KOG Dynein light chain type 1 JGI ISS
PTHR11886Panther DYNEIN LIGHT CHAIN JGI ISS
PTHR11886:SF9Panther CYTOPLASMIC DYNEIN LIGHT CHAIN JGI ISS
PF01221PFAM Dynein light chain type 1 JGI ISS
UniRef100_D7KMR0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dynein light chain type 1 family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KMR0_ARALL SoyBaseE_val: 1.00E-63ISS
UniRef100_I1K5P2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K5P2_SOYBN SoyBaseE_val: 4.00E-94ISS

Expression Patterns of Glyma05g34910
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g34910 not represented in the dataset
Glyma05g34910 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g34910
ParalogEvidenceComments
Glyma08g04800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g34910 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g235900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g34910
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g34910
>Glyma05g34910.1   sequence type=CDS   gene model=Glyma05g34910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTGCAGAGGAGGAGCTAGAAAGAAGAAGCAAGTTTCTCAAAAGCTTGATACAGAAGAAGAAAACCATAGAGCAACAAGAGCAGCATGATCACCTACAACACAACAACGTTCGTGTCAGAGCTTGTGACATGCCTCTCCCTCTTCAGAGCCGTGCCTTTCGATGTGCACGTGATCTCCTGGATTCTATGCCACCAAAGAAGCTTGATAGTAAACGCCTGGCCCTCACACTTAAGAAGGAATTTGATTCTTCTTATGGTCCAGCTTGGCACTGCATTGTGGGTACTAGTTTTGGCTCCTATGTTACTCATTCCCTTGGTGGTTTCGTGTATTTTTCCATTGACAAGGTTTATGTCCTTCTCTTCAAGACAGCTGTTGAACCATTAGACCATTCATAG
Predicted protein sequences of Glyma05g34910
>Glyma05g34910.1   sequence type=predicted peptide   gene model=Glyma05g34910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGAEEELERRSKFLKSLIQKKKTIEQQEQHDHLQHNNVRVRACDMPLPLQSRAFRCARDLLDSMPPKKLDSKRLALTLKKEFDSSYGPAWHCIVGTSFGSYVTHSLGGFVYFSIDKVYVLLFKTAVEPLDHS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo