SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g33970

Feature Type:gene_model
Chromosome:Gm05
Start:38451931
stop:38455187
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g33970
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73640AT Annotation by Michelle Graham. TAIR10: RAB GTPase homolog A6A | chr1:27687033-27687987 FORWARD LENGTH=233 SoyBaseE_val: 1.00E-99ISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0044036GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0087 KOG GTPase Rab11/YPT3, small G protein superfamily JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF213Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_I1K5D8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K5D8_SOYBN SoyBaseE_val: 4.00E-158ISS
UniRef100_Q6ZXT1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Small GTPase n=1 Tax=Medicago sativa RepID=Q6ZXT1_MEDSA SoyBaseE_val: 2.00E-123ISS

Expression Patterns of Glyma05g33970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g33970
ParalogEvidenceComments
Glyma08g05800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g33970 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g244700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g33970
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g33970
>Glyma05g33970.1   sequence type=CDS   gene model=Glyma05g33970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGATGCATTTGATGAAGAGTGTGATTATCTCTTCAAGGCTGTTTTGATCGGAGACTCTGGAGTTGGGAAATCAAATATGCTCTCAAGGTTTGCAAAAGATGAATTCCGCTTGGATTCCAAACCCACCATAGGAGTTGAATTCGCTTACCGGAACATCAGGGTTGGAGACAAACTCATCAAAGCTCAAATATGGGACACTGCCGGCCAAGAAAGGTTTAGAGCAATCACGAGTTCATACTACAGAGGAGCCTTAGGGGCAATGCTAGTGTATGACATAAGCATGAGATCAAGTTATGAGAATGTGAGCAAATGGCTACTGGAGCTAAGGGAGTTTGGAGGTGAAGACATGGTGGTTGTTCTGGTGGGAAACAAATGTGATCTTGATGAATCAAGAGAAGTTGAGAAAGAAGAAGGAAAAGGGTTTGCGGAAACAGAAGGGTTATGCTTCATGGAAACCTCTGCTTTAAAGAATCTGAATGTTGAGGAAGTGTTCTTACAAATGATCACAAGGATTTATGACATGACAAGCCAGAAAAATTTGGCAGCCAAAATGGAGGAGCAACCGATTAATCTTTTGAATGGGAAAGAGATCCATATAGCTGATGAAGTGACTGCAACTAAACAAACTAGTACTTGCTGTTCAAGATGA
Predicted protein sequences of Glyma05g33970
>Glyma05g33970.1   sequence type=predicted peptide   gene model=Glyma05g33970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADAFDEECDYLFKAVLIGDSGVGKSNMLSRFAKDEFRLDSKPTIGVEFAYRNIRVGDKLIKAQIWDTAGQERFRAITSSYYRGALGAMLVYDISMRSSYENVSKWLLELREFGGEDMVVVLVGNKCDLDESREVEKEEGKGFAETEGLCFMETSALKNLNVEEVFLQMITRIYDMTSQKNLAAKMEEQPINLLNGKEIHIADEVTATKQTSTCCSR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo