SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma05g33860

Feature Type:gene_model
Chromosome:Gm05
Start:38385930
stop:38387077
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18250AT Annotation by Michelle Graham. TAIR10: Pathogenesis-related thaumatin superfamily protein | chr1:6277024-6278005 REVERSE LENGTH=244 SoyBaseE_val: 4.00E-135ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
PF00314PFAM Thaumatin family JGI ISS
UniRef100_B9T3K3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein P21, putative n=1 Tax=Ricinus communis RepID=B9T3K3_RICCO SoyBaseE_val: 3.00E-141ISS
UniRef100_I1K5C5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K5C5_SOYBN SoyBaseE_val: 5.00E-178ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g05820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g245800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g33860.1   sequence type=CDS   gene model=Glyma05g33860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGACTCTTAGACCCATTCTCACCACCATCTTCTTCCTCTTCACAGTGCTCAAGGTTTCAGCATCATCGTCAGTGATATTCTACAACAAGTGCCCCCACCCAGTGTGGCCCGGGATCCAGCCCAGCGCAGGAAAGCCCGTTCTGGCCCGCGGAGGCTTCAAGCTCGCCCCAAACCGGGCCTACTCCCTCCAGCTACCCGCCCTCTGGTCCGGGCGCTTCTGGGGCCGCCACGGCTGCGCCTTCGACGTCGGCGGGCGCGGGCGCTGCGCCACCGGTGACTGCGGCGGGTCCCTCTTCTGCAACGGCATCGGGGGAAGCCCACCGGCGACCCTGGCGGAGTTGACCCTGGGCAACGAGCAGGACTTCTACGACGTGAGCCTGGTGGACGGCTACAACCTGCCCATCTCCATCACCCCATTCAAGGGATCCGGAAAATGCAGCTACGCGGGCTGCGTGAGCGACCTGAACACCATGTGCCCCGTGGGCCTCCAAGTTCGCTCACGCGACAACAAGCGCGTGGTTGCCTGCAAGAGCGCTTGCTCCGCTTTCAACTCCCCCAAGTACTGCTGCACCGGCTCCTATGGAAGCCCACAGGCCTGCAAGCCCACCGTCTATTCCAAGATCTTCAAGACCGCATGCCCCAAGGCCTACTCCTATGCCTATGATGACCCCACCAGCATTGCTACTTGCACCAAAGCTAACTATTTCCTCACCTTCTGCCCCCATCGCCCCTGA

>Glyma05g33860.1   sequence type=predicted peptide   gene model=Glyma05g33860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPTLRPILTTIFFLFTVLKVSASSSVIFYNKCPHPVWPGIQPSAGKPVLARGGFKLAPNRAYSLQLPALWSGRFWGRHGCAFDVGGRGRCATGDCGGSLFCNGIGGSPPATLAELTLGNEQDFYDVSLVDGYNLPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSAFNSPKYCCTGSYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIATCTKANYFLTFCPHRP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo