Glyma05g33820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g33820

Feature Type:	gene_model
Chromosome:	Gm05
Start:	38357517
stop:	38361122
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g33820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G17400	AT	Annotation by Michelle Graham. TAIR10: endoplasmic reticulum-adenine nucleotide transporter 1 \| chr5:5729015-5730104 REVERSE LENGTH=306	SoyBase	E_val: 6.00E-163	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0048316	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed development	SoyBase	N/A	ISS
GO:0048364	GO-bp	Annotation by Michelle Graham. GO Biological Process: root development	SoyBase	N/A	ISS
GO:0051503	GO-bp	Annotation by Michelle Graham. GO Biological Process: adenine nucleotide transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005789	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005471	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP:ADP antiporter activity	SoyBase	N/A	ISS
KOG0749	KOG	Mitochondrial ADP/ATP carrier proteins	JGI		ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF35	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_G7LE57	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ADP,ATP carrier protein n=1 Tax=Medicago truncatula RepID=G7LE57_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1K5C1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K5C1_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma05g33820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g33820

Paralog	Evidence	Comments
Glyma08g05860	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g33820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g246200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g33820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g33820

Limit To All Plant Sequences

>Glyma05g33820.1   sequence type=CDS   gene model=Glyma05g33820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCAAATCAACATATGAAAGATTTTCAAAGGATTTTGTAATGGGAGGAGTAGCAGCAATCATATCAAGGAGTGCAGCGGCACCAATTGAGAGAGTGAAGCTTTTATTGCAAAACCAAGGTGAAATGATTAAAAGAGGACAACTCAAAAAACCATACTTGGGTGTGTCTGATGGCTTTAAGAGGGTCTTCATGGAAGAGGGTTTGATTGCCTTTTGGAGAGGTCACCAGGCCAATCTTATTCGATATTTCCCCACACAGGCTTTCAATTTTGCATTCAAAGGTTACTTCAAAAGCATTTTTGGGTATTCCAAAGAGAGAGACGGGTACATTAAGTGGTTTGCTGGGAATGTGGCTTCAGGCAGTGCTGCAGGAGCGACTACTTCACTACTTCTGTATCATTTAGATTATGCACGTACTAGATTGGGCACCGATGCAATAGAGTGCCGTGTTACCGGTCAACGCCAGTTTAAAGGACTAATTGATGTATACCGGAAGACCTTATCAAGTGATGGAATTGCTGGCTTGTACAGGGGATTTGGGATTTCAATATGGGGAATCACCTTGTATCGAGGGATGTACTTTGGGATCTATGACACCATGAAGCCTATTGTTTTGGTTGGGCCTTTTGAGGGGAAGTTTCTCGCTAGTTTCTTCTTAGGTTGGAGCATCACAACTTTTTCAGCGGTTTGTGCATACCCTTTTGACACATTGCGCCGGCGAATGATGCTTACCTCTGGACATCCAAACAAGTACTGTACTGCAATACATGCATTTCAAGAGATTGTTCGACAGGAGGGTTTCCGAGCTCTATTTCGAGGATTTACCGCAAATATGCTTCTAGGCATGGCAGGAGCTGGAGTGCTTGCTGGATACGATCAGCTGAACCGTATCTCATCTAGACACAGTCACTATAATGAGACTAACCAAAGAGTTCTGAAATGA

Predicted protein sequences of Glyma05g33820

Limit To All Plant Sequences

>Glyma05g33820.1   sequence type=predicted peptide   gene model=Glyma05g33820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKSTYERFSKDFVMGGVAAIISRSAAAPIERVKLLLQNQGEMIKRGQLKKPYLGVSDGFKRVFMEEGLIAFWRGHQANLIRYFPTQAFNFAFKGYFKSIFGYSKERDGYIKWFAGNVASGSAAGATTSLLLYHLDYARTRLGTDAIECRVTGQRQFKGLIDVYRKTLSSDGIAGLYRGFGISIWGITLYRGMYFGIYDTMKPIVLVGPFEGKFLASFFLGWSITTFSAVCAYPFDTLRRRMMLTSGHPNKYCTAIHAFQEIVRQEGFRALFRGFTANMLLGMAGAGVLAGYDQLNRISSRHSHYNETNQRVLK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain