SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g33760

Feature Type:gene_model
Chromosome:Gm05
Start:38324815
stop:38325742
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g33760
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18290AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: chloroplast; EXPRESSED IN: root; Has 94 Blast hits to 94 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 94; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:6297436-6297966 FORWARD LENGTH=176 SoyBaseE_val: 1.00E-31ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1K5B3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K5B3_SOYBN SoyBaseE_val: 1.00E-120ISS
UniRef100_Q9LE02UniRef Annotation by Michelle Graham. Most informative UniRef hit: F15H18.19 n=1 Tax=Arabidopsis thaliana RepID=Q9LE02_ARATH SoyBaseE_val: 7.00E-29ISS

Expression Patterns of Glyma05g33760
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g33760
ParalogEvidenceComments
Glyma08g05960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g33760 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g246800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g33760
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g33760
>Glyma05g33760.1   sequence type=CDS   gene model=Glyma05g33760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAATGTAGCTTCATGCACTCCTTCCTTGACACCTAATGGGGTCTTCAAGGTCCTATTCTTAGATGGGAGGCTGGAGGCCTACACAAAACCTATGAGAGCTGCAGAACTGATGCTAGAATACTCTGGACAGTTTGTTTGTGACTCTAGCTACCTCAAAGTCGGACATCGCATTCATGGGCTTCTAGCTGATGACCAACTTGAAAAGCGCAAATTCTACTTCCTTCTACCAATAGAGCTGCTCTTCTCTGTGCTAACCCATGAAGAAATGAGCTCTCTTAATTACAAAGCATCCAGGGCTACCAAGCACGCAAGTTTTAACAACTTGGGAAAGATTTTTCCAGTGTTTAGTGAATTTTGTATGTTCCCTTCTGAGCTTAAGAGATTAGAAGAAGCTGATAATCAGCTTCAGGTGGTAAGGGACCCAGAACCAGCCGTCAAAAGGTACTCCAAGCAGAGATCTTGGAGACCGGCACTGGAGACCATTGATGAAACTCTATGA
Predicted protein sequences of Glyma05g33760
>Glyma05g33760.1   sequence type=predicted peptide   gene model=Glyma05g33760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNVASCTPSLTPNGVFKVLFLDGRLEAYTKPMRAAELMLEYSGQFVCDSSYLKVGHRIHGLLADDQLEKRKFYFLLPIELLFSVLTHEEMSSLNYKASRATKHASFNNLGKIFPVFSEFCMFPSELKRLEEADNQLQVVRDPEPAVKRYSKQRSWRPALETIDETL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo