Glyma05g32850 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g32850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g32850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g32850

Feature Type:	gene_model
Chromosome:	Gm05
Start:	37649731
stop:	37651660
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g32850

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01720	AT	Annotation by Michelle Graham. TAIR10: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein \| chr1:268471-269514 FORWARD LENGTH=289	SoyBase	E_val: 5.00E-121	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007275	GO-bp	Annotation by Michelle Graham. GO Biological Process: multicellular organismal development	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009788	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF02365	PFAM	No apical meristem (NAM) protein	JGI		ISS
UniRef100_B2ZGR9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAC domain protein (Fragment) n=1 Tax=Glycine max RepID=B2ZGR9_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_UPI000189D265	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000189D265 related cluster n=1 Tax=unknown RepID=UPI000189D265	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma05g32850

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g32850 not represented in the dataset	Glyma05g32850 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g32850 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g195000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g32850

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g32850

Limit To All Plant Sequences

>Glyma05g32850.1   sequence type=CDS   gene model=Glyma05g32850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGGAGAACTCCAATTACCACCCGGGTTCAGATTCCACCCCACTGACGATGAGCTTGTGAATCACTACTTGTGTAGAAAGTGTGCTGCACAAACCATTGCTGTTCCCATCATCAAAGAAATCGATTTGTACAAGTTTGATCCATGGCAGCTTCCAGAGATGGCTCTTTACGGTGAGAAAGAGTGGTACTTTTTCTCTCCTCGAGACCGAAAATACCCAAACGGTTCGAGACCGAACCGGGCTGCCGGAAGCGGGTACTGGAAGGCTACCGGAGCTGACAAACCGATCGGAAAACCGAAAGCCCTTGGAATCAAGAAGGCCCTCGTGTTCTACGCGGGCAAAGCCCCAAAGGGAGTGAAGACCAATTGGATCATGCACGAATATCGCTTAGCCAACGTCGACAGATCCGCCTCAAAAAAAAACACCACCACCAACAACTTGAGGCTTGATGATTGGGTTTTGTGCCGAATTTACAACAAGAAAGGGAAGATTGAGAAGTACAATGGTGTTGCGGTGGTGGATCAGAAAGTGGCCAAGTTATCAGAAGAGGAGGTTCAGTTCCAGCACGAGACCAAGCCTCAGATCAAGATGTACGGCCACGATGATTTCAGGAACGACCAATTGTACATGGACACGTCGGATTCGGGGCCCAGGTTGCACACGGACTCCAGCTGCTCCGAGCACGTGGTTTCGCCCGATGGCACGTGCGAGAAGGAGGTGCAGAGCGAGCCCAAGTGGAATGATCTTGAGTTGGGCCCCGACCCAGCCTTGGGCTTCGATTTTAATTTCATGGACCTGACCTCAGATGACGCTTTTGCCCCTCAGGTTCAATACCAAATCAACCATCTCTCACCGTGGCAAGAAATGTTCACGTACCTACCAAAGACATTTTGA

Predicted protein sequences of Glyma05g32850

Limit To All Plant Sequences

>Glyma05g32850.1   sequence type=predicted peptide   gene model=Glyma05g32850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPGELQLPPGFRFHPTDDELVNHYLCRKCAAQTIAVPIIKEIDLYKFDPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGKPKALGIKKALVFYAGKAPKGVKTNWIMHEYRLANVDRSASKKNTTTNNLRLDDWVLCRIYNKKGKIEKYNGVAVVDQKVAKLSEEEVQFQHETKPQIKMYGHDDFRNDQLYMDTSDSGPRLHTDSSCSEHVVSPDGTCEKEVQSEPKWNDLELGPDPALGFDFNFMDLTSDDAFAPQVQYQINHLSPWQEMFTYLPKTF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain