SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g32756

Feature Type:gene_model
Chromosome:Gm05
Start:37589565
stop:37596078
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g32756
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52430AT Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein | chr3:19431566-19434292 FORWARD LENGTH=541 SoyBaseE_val: 9.00E-83ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0002213GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to insect SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009581GO-bp Annotation by Michelle Graham. GO Biological Process: detection of external stimulus SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009625GO-bp Annotation by Michelle Graham. GO Biological Process: response to insect SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0010618GO-bp Annotation by Michelle Graham. GO Biological Process: aerenchyma formation SoyBaseN/AISS
GO:0010942GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell death SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0045088GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of innate immune response SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004806GO-mf Annotation by Michelle Graham. GO Molecular Function: triglyceride lipase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016298GO-mf Annotation by Michelle Graham. GO Molecular Function: lipase activity SoyBaseN/AISS
PF01764PFAM Lipase (class 3) JGI ISS
UniRef100_D2DF32UniRef Annotation by Michelle Graham. Best UniRef hit: PAD4 n=1 Tax=Glycine max RepID=D2DF32_SOYBN SoyBaseE_val: 0ISS
UniRef100_D2DF32UniRef Annotation by Michelle Graham. Most informative UniRef hit: PAD4 n=1 Tax=Glycine max RepID=D2DF32_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma05g32756
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g32756 not represented in the dataset
Glyma05g32756 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g32756
ParalogEvidenceComments
Glyma08g00420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g32756 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g194100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g32756
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g32756
>Glyma05g32756.1   sequence type=CDS   gene model=Glyma05g32756   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATTCAAAGCCTCGAAACTTTCGAGGAAAAGTGGAAGCAATTGAGTTGAGTAGAATCGAATCGATCCGTGGTGGCAGGTTTGAGTCCCGCGAGATGCTCGCAACCTTCGTCTCGTCCACGCCGCTGCTGTCGGAGTCATGGCGCCTCTGCAGCCAGGCCAACGCCACTCCCTTCCGGACCTTCGTAACGGAGCGCGTCGGCGCCGCCGTCTACGTCGCCTTCTCCGGCGTCCACATGGCCGGCGAGTCCGACCCGAATTGGAGAAGTTTGATTCCGTTGGACAGCATCGGCGGTGTTCCTCTGTTTTCGTCGCGGCGGAGCAAGGAAGGGGAGGAGCCGGTCATGGTTCACGCCGGCATGCTCAATCTCTTCTTCTCACTTTTCAATTCTTTCCAGAACCAGATGTTGGAAATAGTGGGAAGCAAAGACACTAAATCAGTTGTCATCACTGGACATTCCATTGGAGGAGCCACTGCCTCTTTGTGCACACTCTGGCTTCTGTCCTACCTCCAATCCATCTCTTCATCAGTGTCAGTATTGTGCATCACTTATGGGGCACCATTGCTTGGGAACGAGTCCTTTTCCCAAATCATTTTCAAAGAAAGATGGGGTGGCAACTTCTGCCACGTGGTGTCAAAGCATGACATAATGCCAAGGTTGCTCTTTGCCCCTATAACCTCTCTCTCTACTCAGTTAAATTCCCTGCTACAGTTTTGGCACTTGTCGATGACTTCACCAGATATGGGGAAGCTTGCAAATCAGATATCTGAAAAAGAGAAAGATAAGTTGTTCACTGCTGTAGTAGATTACTTGGAAACGGCAACACAAGATGGAGAAACATCAGTGCCAATTTTGTTTCACCCTTTTGGGAGCTACTTTTTTGTCTCAGAAGAAGGAGCCGTGTGTGTGGATAGTTCAGCTGCTATTATAAAGATGATGCACTTGACGCTTGCAACTAGTTCTCCAGCTAGTAGTATTGAGGACCATCTGAAATATGGGGATTATGTCAATAAAATGTCTGCACAAACATTGTATCAGAGCAACTCCATGCAAAAGAGCATTCCTGATTCGAGCTATGAAGCAGGGCTTGAATTGGCCATTCAGTCTTCTGGCATAGCAAACCAGGAATCAGCTATTACATCCGCCAAGGAATGTCTGAAGACAACAAGGAGAATGGGTCCTTCACCAACCCTGAATGCTGCAAGCCTAGCACTGAGCTTATCCAAGGTGGTACCTTATAGAGCGCAAATAGAATGGTACAAGACTTGGTGCGAAAAACAAGATGACCAAATGGGTTATTATGACTCATTCAAAAGCAGGAACTCTTCCAGTTCCAAAAGGGGCATGAAAGTCAACATCAACCGTTGCAAGCTTGCCAGGTTTTGGAACAACGTTATTGACATGTTGGAAAGGGGTGAGCTACCTCATGATTTTGACAAGAGAGCCAAGTGGGTCTATACTTCACACTTCTATAAGCTATTGAATTCAAGTTACAGTATATGGGTGGAGGATTTAAGAGAACTGAAACAACTGAAAGCAAAGGTGCAAAGGTTTCCTCATCAGTTTACTGGTTTTCTAGATGGGGAAGTAGTTCCTTAG
Predicted protein sequences of Glyma05g32756
>Glyma05g32756.1   sequence type=predicted peptide   gene model=Glyma05g32756   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NSKPRNFRGKVEAIELSRIESIRGGRFESREMLATFVSSTPLLSESWRLCSQANATPFRTFVTERVGAAVYVAFSGVHMAGESDPNWRSLIPLDSIGGVPLFSSRRSKEGEEPVMVHAGMLNLFFSLFNSFQNQMLEIVGSKDTKSVVITGHSIGGATASLCTLWLLSYLQSISSSVSVLCITYGAPLLGNESFSQIIFKERWGGNFCHVVSKHDIMPRLLFAPITSLSTQLNSLLQFWHLSMTSPDMGKLANQISEKEKDKLFTAVVDYLETATQDGETSVPILFHPFGSYFFVSEEGAVCVDSSAAIIKMMHLTLATSSPASSIEDHLKYGDYVNKMSAQTLYQSNSMQKSIPDSSYEAGLELAIQSSGIANQESAITSAKECLKTTRRMGPSPTLNAASLALSLSKVVPYRAQIEWYKTWCEKQDDQMGYYDSFKSRNSSSSKRGMKVNINRCKLARFWNNVIDMLERGELPHDFDKRAKWVYTSHFYKLLNSSYSIWVEDLRELKQLKAKVQRFPHQFTGFLDGEVVP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo