SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g32590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g32590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g32590

Feature Type:gene_model
Chromosome:Gm05
Start:37485306
stop:37486629
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g32590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G64530AT Annotation by Michelle Graham. TAIR10: xylem NAC domain 1 | chr5:25795360-25796699 FORWARD LENGTH=187 SoyBaseE_val: 7.00E-56ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007275GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organismal development SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0043067GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of programmed cell death SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF02365PFAM No apical meristem (NAM) protein JGI ISS
UniRef100_B2ZGR0UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAC domain protein (Fragment) n=1 Tax=Glycine max RepID=B2ZGR0_SOYBN SoyBaseE_val: 2.00E-85ISS
UniRef100_UPI000233A6CCUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A6CC related cluster n=1 Tax=unknown RepID=UPI000233A6CC SoyBaseE_val: 1.00E-150ISS

Expression Patterns of Glyma05g32590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g32590 not represented in the dataset
Glyma05g32590 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g32590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g192500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g32590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g32590
>Glyma05g32590.2   sequence type=CDS   gene model=Glyma05g32590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGCTTGTGGAAGTGTCAACCTTCCTCCTGGCTTTTGCTTCTCTCCAACTGATGAAGAACTCGTCCTTCACTTTCTCTGTTCCAAGGCTTCTCTACCATGCCATCCCAACATCATTCCAGAGCTTGACCTCTCTCTGCTTGATCCATGGGAATTAAATGGTAAGGCGTTGTCAAGTGGAAATCAACACTATTTCTTCACCAAAGTGAAGGAGAACAGATCCACAGAAAATGGGTATTGGAAGGAAATAGGAGTCATGGAACCAATAGTATCCTCTTCTGAAAAAGTGGGGATCAAGAAGTACCTTGTGTTCAACCTTGGTGAAGCTCCACAAGGCACTGAAACCAGTTGGGTCATGCAAGAATATCATATTTGCTCATCCGGGTTTAACACTACTACTGCATCTAATTGTGCAAGTACTCGCGGAAGACGAAAAACTGATCAATGTGGGAGCAAATGGGTATTGTGCAAAGCCTATGAAAAGAAAAGTTGTCAATCCCAACAAGGTGTAAATTGTTACAGCGATGAGGATGACTGCGGAACTGAGCTTTCATGGCTAGACGAATTTTATATGTCGTTAGATGATGATCTTGAAGAAGTTATGAGCCTGCCTAGCTAA
Predicted protein sequences of Glyma05g32590
>Glyma05g32590.2   sequence type=predicted peptide   gene model=Glyma05g32590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMACGSVNLPPGFCFSPTDEELVLHFLCSKASLPCHPNIIPELDLSLLDPWELNGKALSSGNQHYFFTKVKENRSTENGYWKEIGVMEPIVSSSEKVGIKKYLVFNLGEAPQGTETSWVMQEYHICSSGFNTTTASNCASTRGRRKTDQCGSKWVLCKAYEKKSCQSQQGVNCYSDEDDCGTELSWLDEFYMSLDDDLEEVMSLPS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo