SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g32350

Feature Type:gene_model
Chromosome:Gm05
Start:37280508
stop:37281515
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g32350
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18690AT Annotation by Michelle Graham. TAIR10: MAP kinase substrate 1 | chr3:6429755-6430423 REVERSE LENGTH=222 SoyBaseE_val: 2.00E-29ISS
GO:0009870GO-bp Annotation by Michelle Graham. GO Biological Process: defense response signaling pathway, resistance gene-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF05678PFAM VQ motif JGI ISS
UniRef100_G7LD80UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein MKS1 n=1 Tax=Medicago truncatula RepID=G7LD80_MEDTR SoyBaseE_val: 9.00E-85ISS
UniRef100_I1K4X4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K4X4_SOYBN SoyBaseE_val: 6.00E-144ISS

Proteins Associated with Glyma05g32350
LocusGene SymbolProtein Name
VQ19 VQ motif containing protein gene 19

Expression Patterns of Glyma05g32350
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g32350
ParalogEvidenceComments
Glyma08g15620 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g32350 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g190000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g32350
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g32350
>Glyma05g32350.1   sequence type=CDS   gene model=Glyma05g32350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCCGCCGGAATTCCCCTCCGCCGCCGCCGGAACATCTTCGCCGCCGGGAAAGAAAGAGCTCCAGCTCCAAGGGACACGCCCGCCGCCGCTCAGAGTCAGCAAAGACTCCCACAAGATCCGCAAACCGCCGCTTCCCCCCACCGCACACCAACCGGCGCCGCCGCCGCCGCCGGAGCAGCGGAAGCCGGTGATCATCTACACCGTGTCTCCCAAAGTCCTCCACGTCACCGTCAGCGACTTCATGAACGTCGTTCAGCGCCTCACCGGACCCTCCTCCGGCGCAGAACCCAATCTCCGAGCCGGCGACGTATCGCCGGCGGCGAGACTCGCGTCGATCGAGAGAACGAGCCCGTCGGAGAGGGAGAAAGTTCGCAGCGAAGACAACGACGTGACGTTGATGTTAGAAGGAGTGGAAGTGGGTCAATTCCCCGGAATATTGTCGCCGGCGACGTTGCCCCCGATATCACCAGGGTTTTTCTCGGAATCGCAAACGACGTCTTTTTGGAATGACTTGAGCCCCTTTTGGTCAACGACCAGCTTCATTGCGAGTCCGTCGGGGCTTTTTCCCGGCAACGTGATGTCTCCGCTGCCGTCGCCGGACATCTTTAATCTCTTTTACTAA
Predicted protein sequences of Glyma05g32350
>Glyma05g32350.1   sequence type=predicted peptide   gene model=Glyma05g32350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPPEFPSAAAGTSSPPGKKELQLQGTRPPPLRVSKDSHKIRKPPLPPTAHQPAPPPPPEQRKPVIIYTVSPKVLHVTVSDFMNVVQRLTGPSSGAEPNLRAGDVSPAARLASIERTSPSEREKVRSEDNDVTLMLEGVEVGQFPGILSPATLPPISPGFFSESQTTSFWNDLSPFWSTTSFIASPSGLFPGNVMSPLPSPDIFNLFY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo