SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g31820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g31820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g31820

Feature Type:gene_model
Chromosome:Gm05
Start:36865176
stop:36868848
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10500AT Annotation by Michelle Graham. TAIR10: chloroplast-localized ISCA-like protein | chr1:3460160-3461340 REVERSE LENGTH=180 SoyBaseE_val: 2.00E-77ISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0051536GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding SoyBaseN/AISS
KOG1120 KOG Fe-S cluster biosynthesis protein ISA1 (contains a HesB-like domain) JGI ISS
PTHR10072Panther HES-B RELATED JGI ISS
PTHR10072:SF31Panther IRON-SULFUR CLUSTER ASSEMBLY PROTEIN JGI ISS
PF01521PFAM Iron-sulphur cluster biosynthesis JGI ISS
UniRef100_E4MXL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-34-D04 n=1 Tax=Eutrema halophilum RepID=E4MXL6_THEHA SoyBaseE_val: 7.00E-77ISS
UniRef100_I1K4R9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K4R9_SOYBN SoyBaseE_val: 1.00E-119ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g31820 not represented in the dataset

Glyma05g31820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g15090 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g184700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g31820.1   sequence type=CDS   gene model=Glyma05g31820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTCTCTGCAATGACTAGCATGCACTCTCCTCAATTTCTCCGCCTTCCCATCTCCCTTCCCCGTTCTTCACCCTCTGGTCGATTTTCACCGCCAATTCTCAAACGCCCTAAACCACTCTCCATTCGATCAGTTTCAATTCCTGCTGCACCAGCATCAGGGTCTCTGGCCCCTGCAATTTCTGTTACGGATAATGTGCTGAAGCACTTGAATAAGATGAGGTCTGAACGAAATCAAGATTTATGTTTAAGAATAGGTGTCAAACAGGGTGGGTGCTCTGGTATGTCATACACAATGGATTTTGAAGACAGGGTTAATAAAAGGCCAGATGATTCAATCATTGAGTATGAAGGTTTTGAAATTGTTTGTGATCCTAAGAGCCTACTCTTCATATTTGGCATGCAATTAGATTACAGTGATGCTCTGATTGGGGGAGGCTTCTCTTTCAAGAATCCTAACGCGACACAGACTTGTGGATGTGGTAAATCCTTTGCTGCCGAAATTTAG

>Glyma05g31820.1   sequence type=predicted peptide   gene model=Glyma05g31820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFSAMTSMHSPQFLRLPISLPRSSPSGRFSPPILKRPKPLSIRSVSIPAAPASGSLAPAISVTDNVLKHLNKMRSERNQDLCLRIGVKQGGCSGMSYTMDFEDRVNKRPDDSIIEYEGFEIVCDPKSLLFIFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFAAEI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo