SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g31710

Feature Type:gene_model
Chromosome:Gm05
Start:36805009
stop:36806784
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g31710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G21970AT Annotation by Michelle Graham. TAIR10: stress enhanced protein 2 | chr2:9357188-9357874 REVERSE LENGTH=202 SoyBaseE_val: 1.00E-71ISS
GO:0009765GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
UniRef100_B9H5A9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Stress enhanced protein 2 n=1 Tax=Populus trichocarpa RepID=B9H5A9_POPTR SoyBaseE_val: 2.00E-85ISS
UniRef100_I1K4P7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K4P7_SOYBN SoyBaseE_val: 8.00E-149ISS

Expression Patterns of Glyma05g31710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g31710
ParalogEvidenceComments
Glyma08g14960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g31710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g183500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g31710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g31710
>Glyma05g31710.1   sequence type=CDS   gene model=Glyma05g31710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGCTCTCCCAAAATCCTTTCTCTCTATGGCATCTGCAACACGTTTAGTGCACTGCGAGCTGCGGTCGGCGAGGCCCGCGGTTCGGGCGAGGGAACCGGCCGGTCCGGTTCAGGTTACGATCCCGAAACCCAAAGCGGCGGAGGCGGAAGGCGCGAACATCGTTTTGCAGCCGCGGTTGTGCACTCTGAGATCCTACGGTTCGGATCGAGCGGGGGTTCTGATCAAGGCCCGCAAGGAGGGTGACGATGATGACGTGTCCCCCTTCTTCGCCGCTCTTTCCGACTATATTGAGAGCTCTAAGAAAAGTCATGATTTTGAGATCATCTCTGGTCGTCTAGCTATGATGGTGTTTGCAGCGACGGTGACAATGGAAATGGTGACAGGAAACTCTATGTTCAGAAAGATGGACATTGAAGGAATCACAGAGGCTGGTGGGGTGTGTTTGGGTGCAGTAACTTGTGCAGCACTCTTTGCATGGTTCTCCAGTGCTCGAAACAGAGTTGGTCGAATCTTCACCGTCAGCTGCAACGCATTCATCGATTCCGTAATTGACCAAATCGTAGATGGTTTGTTCTATGAAGGCGACGACCCTACTGATTGGCCCGATGAACCGTGA
Predicted protein sequences of Glyma05g31710
>Glyma05g31710.1   sequence type=predicted peptide   gene model=Glyma05g31710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLALPKSFLSMASATRLVHCELRSARPAVRAREPAGPVQVTIPKPKAAEAEGANIVLQPRLCTLRSYGSDRAGVLIKARKEGDDDDVSPFFAALSDYIESSKKSHDFEIISGRLAMMVFAATVTMEMVTGNSMFRKMDIEGITEAGGVCLGAVTCAALFAWFSSARNRVGRIFTVSCNAFIDSVIDQIVDGLFYEGDDPTDWPDEP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo