Report for Sequence Feature Glyma05g31330
Feature Type: gene_model
Chromosome: Gm05
Start: 36452806
stop: 36455568
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g31330
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G39740 AT
Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr4:18435586-18437095 REVERSE LENGTH=276
SoyBase E_val: 1.00E-98 ISS
GO:0055070 GO-bp
Annotation by Michelle Graham. GO Biological Process: copper ion homeostasis
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR12151 Panther
SCO1/SENC
JGI ISS
PF02630 PFAM
SCO1/SenC
JGI ISS
UniRef100_D7M949 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Electron transport SCO1/SenC family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M949_ARALL
SoyBase E_val: 1.00E-96 ISS
UniRef100_UPI000233A3D9 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233A3D9 related cluster n=1 Tax=unknown RepID=UPI000233A3D9
SoyBase E_val: 2.00E-148 ISS
Expression Patterns of Glyma05g31330
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma05g31330
Paralog Evidence Comments
Glyma08g14570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g31330 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma05g31330
Coding sequences of Glyma05g31330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g31330.2 sequence type=CDS gene model=Glyma05g31330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
CCAGCTGCTGTTCTAGGATTTGCCGGGCTTGCAGCTTTTTTTCACTACAATGATGAGAGGAGAGCGGTTCCCAAAGGTCATCAGGGTGGTGGCCTCAGAAATGTTGCCAATGGACCCATAATTGGGGGTCCATTTACACTAATTAATACAGAGAAACAGGCAATTACAGAACATAATTTTCTTGGGAATTGGGTCCTGCTCTACTTTGGCTATACCTCATCCCCCGATTGTGGGCCAGAGCAAGTCCAAATTATGGCCAAGGCAATTGATATATTAGAATCAAAACAGAATCTTAAGATTCTACCAGTATTTGTTTCCACTGATCCTCAACGTGATACGCCCTCACAACTTCGTGCCTACCTTAAAGAGTTTGACTCAAGAATCATAGGATTAACTGGACCTGTTGCAGCTATTAGGCAGATGGCTCAAGAATATTGTTTTTACTTTAAAAAGGTAGAAGAGGATGGCAGTGATTATCTTGTTGACTGTTCTCACAACATGTATTTGCTGAATCCTAAAATGGAGGTTACGAGATGCTTTGGTGTCGAGTATAATGCAGAGGAGTTGTCAGAAGTGATAGGGAAAGAGCTGAACAGAAACCCCTCTTAA
Predicted protein sequences of Glyma05g31330
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g31330.2 sequence type=predicted peptide gene model=Glyma05g31330 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
PAAVLGFAGLAAFFHYNDERRAVPKGHQGGGLRNVANGPIIGGPFTLINTEKQAITEHNFLGNWVLLYFGYTSSPDCGPEQVQIMAKAIDILESKQNLKILPVFVSTDPQRDTPSQLRAYLKEFDSRIIGLTGPVAAIRQMAQEYCFYFKKVEEDGSDYLVDCSHNMYLLNPKMEVTRCFGVEYNAEELSEVIGKELNRNPS*